Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281134_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using IFIH1 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Mouse IFIH1 Polyclonal Antibody | anti-IFIH1 antibody

IFIH1 Polyclonal Antibody

Gene Names
IFIH1; AGS7; Hlcd; MDA5; MDA-5; RLR-2; IDDM19; SGMRT1
Reactivity
Human, Mouse
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
IFIH1, Antibody; IFIH1 Polyclonal Antibody; AGS7; Hlcd; IDDM19; MDA-5; MDA5; RLR-2; SGMRT1; anti-IFIH1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSES
Sequence Length
1025
Applicable Applications for anti-IFIH1 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human IFIH1
Immunogen Species
Human
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of A549 cells using IFIH1 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281134_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using IFIH1 antibody. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of THP-1 cells, using IFIH1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA281134_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of THP-1 cells, using IFIH1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-IFIH1 antibody
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation in this gene is associated with diabetes mellitus insulin-dependent type 19.
Product Categories/Family for anti-IFIH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 25kDa; 116kDa
Observed: 117kDa
NCBI Official Full Name
interferon-induced helicase C domain-containing protein 1
NCBI Official Synonym Full Names
interferon induced with helicase C domain 1
NCBI Official Symbol
IFIH1
NCBI Official Synonym Symbols
AGS7; Hlcd; MDA5; MDA-5; RLR-2; IDDM19; SGMRT1
NCBI Protein Information
interferon-induced helicase C domain-containing protein 1
UniProt Protein Name
Interferon-induced helicase C domain-containing protein 1
UniProt Gene Name
IFIH1
UniProt Synonym Gene Names
MDA5; RH116; CADM-140 autoantigen; Helicard; MDA-5; RLR-2

Similar Products

Product Notes

The IFIH1 ifih1 (Catalog #AAA281134) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFIH1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IFIH1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the IFIH1 ifih1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSNGYSTDEN FRYLISCFRA RVKMYIQVEP VLDYLTFLPA EVKEQIQRTV ATSGNMQAVE LLLSTLEKGV WHLGWTREFV EALRRTGSPL AARYMNPELT DLPSPSFENA HDEYLQLLNL LQPTLVDKLL VRDVLDKCME EELLTIEDRN RIAAAENNGN ESGVRELLKR IVQKENWFSA FLNVLRQTGN NELVQELTGS DCSES. It is sometimes possible for the material contained within the vial of "IFIH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.