Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198080_WB11.jpg WB (Western Blot) (WB Suggested Anti-IFIH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit IFIH1 Polyclonal Antibody | anti-IFIH1 antibody

IFIH1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
IFIH1; AGS7; Hlcd; MDA5; MDA-5; RLR-2; IDDM19; SGMRT1
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
IFIH1, Antibody; IFIH1 antibody - middle region; anti-IFIH1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED
Sequence Length
1025
Applicable Applications for anti-IFIH1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 85%; Horse: 85%; Human: 100%; Mouse: 77%; Pig: 77%; Rat: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IFIH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IFIH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

product-image-AAA198080_WB11.jpg WB (Western Blot) (WB Suggested Anti-IFIH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

WB (Western Blot)

(Lanes:1: 20ug HEK293T no transfection, 2: 20ug HEK293T 3DYKDDDDK-MDA5/IFIH1Primary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:1000Gene Name:IFIH1Submitted by:Dr. Safia Deddouche, London Research InstituteIFIH1 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA198080_WB13.jpg WB (Western Blot) (Lanes:1: 20ug HEK293T no transfection, 2: 20ug HEK293T 3DYKDDDDK-MDA5/IFIH1Primary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:1000Gene Name:IFIH1Submitted by:Dr. Safia Deddouche, London Research InstituteIFIH1 is supported by BioGPS gene expression data to be expressed in HEK293T)

IHC (Immunohistochemistry)

(IHC Information: Paraffin embedded spleen tissue, tested with an antibody Dilution of 5 ug/ml.)

product-image-AAA198080_IHC15.jpg IHC (Immunohistochemistry) (IHC Information: Paraffin embedded spleen tissue, tested with an antibody Dilution of 5 ug/ml.)
Related Product Information for anti-IFIH1 antibody
This is a rabbit polyclonal antibody against IFIH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. IFIH1 is a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
117kDa
NCBI Official Full Name
interferon-induced helicase C domain-containing protein 1
NCBI Official Synonym Full Names
interferon induced with helicase C domain 1
NCBI Official Symbol
IFIH1
NCBI Official Synonym Symbols
AGS7; Hlcd; MDA5; MDA-5; RLR-2; IDDM19; SGMRT1
NCBI Protein Information
interferon-induced helicase C domain-containing protein 1
UniProt Protein Name
Interferon-induced helicase C domain-containing protein 1
UniProt Gene Name
IFIH1
UniProt Synonym Gene Names
MDA5; RH116; CADM-140 autoantigen; Helicard; MDA-5; RLR-2
UniProt Entry Name
IFIH1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IFIH1 ifih1 (Catalog #AAA198080) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFIH1 antibody - middle region reacts with Cow, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFIH1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the IFIH1 ifih1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QINDTIRMID AYTHLETFYN EEKDKKFAVI EDDSDEGGDD EYCDGDEDED. It is sometimes possible for the material contained within the vial of "IFIH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.