FCM/FACS (Flow Cytometry)
(Figure 2. Flow Cytometry analysis of A549 cells using anti-IFNGR1 antibody (AAA46733).Overlay histogram showing A549 cells stained with AAA46733 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IFNGR1 Antibody (AAA46733,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight 488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)
Rabbit anti-Human IFNGR1 Polyclonal Antibody | anti-IFNGR1 antibody
Anti-IFNGR1 Antibody
Gene Names
IFNGR1; CD119; IFNGR; IMD27A; IMD27B
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
IFNGR1, Antibody; Anti-IFNGR1 Antibody; CD 119; CD119; CDw119; IFN gamma R1; IFN-gamma-R1; IFNG R1; IFNGR 1; IFNGR; IFNGR1; IMD27A; IMD27B; P15260; Interferon gamma receptor 1; anti-IFNGR1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
489
Applicable Applications for anti-IFNGR1 antibody
WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
FCM/FACS (Flow Cytometry)
(Figure 2. Flow Cytometry analysis of A549 cells using anti-IFNGR1 antibody (AAA46733).Overlay histogram showing A549 cells stained with AAA46733 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IFNGR1 Antibody (AAA46733,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight 488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)
FCM/FACS (Flow Cytometry)
(Figure 2. Flow Cytometry analysis of A549 cells using anti-IFNGR1 antibody (AAA46733).Overlay histogram showing A549 cells stained with AAA46733 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IFNGR1 Antibody (AAA46733,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight 488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)
WB (Western Blot)
(Figure 1. Western blot analysis of IFNGR1 using anti-IFNGR1 antibody (AAA46733).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HEPG2 whole cell lysates,lane 2: SKOV3 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IFNGR1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for IFNGR1 at approximately 95KD. The expected band size for IFNGR1 is at 54KD.)
WB (Western Blot)
(Figure 1. Western blot analysis of IFNGR1 using anti-IFNGR1 antibody (AAA46733).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HEPG2 whole cell lysates,lane 2: SKOV3 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IFNGR1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for IFNGR1 at approximately 95KD. The expected band size for IFNGR1 is at 54KD.)
Related Product Information for anti-IFNGR1 antibody
Rabbit IgG polyclonal antibody for Interferon gamma receptor 1(IFNGR1) detection.
Background: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
Background: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
References
1. "Entrez Gene: IFNGR1 interferon gamma receptor 1".
2. Aguet M, Dembi? Z, Merlin G (Oct 1988). "Molecular cloning and expression of the human interferon-gamma receptor". Cell. 55 (2): 273-80.
3. Novick D, Orchansky P, Revel M, Rubinstein M (Jun 1987). "The human interferon-gamma receptor. Purification, characterization, and preparation of antibodies". The Journal of Biological Chemistry. 262(18): 8483-7.
2. Aguet M, Dembi? Z, Merlin G (Oct 1988). "Molecular cloning and expression of the human interferon-gamma receptor". Cell. 55 (2): 273-80.
3. Novick D, Orchansky P, Revel M, Rubinstein M (Jun 1987). "The human interferon-gamma receptor. Purification, characterization, and preparation of antibodies". The Journal of Biological Chemistry. 262(18): 8483-7.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,542 Da
NCBI Official Full Name
interferon gamma receptor 1
NCBI Official Synonym Full Names
interferon gamma receptor 1
NCBI Official Symbol
IFNGR1
NCBI Official Synonym Symbols
CD119; IFNGR; IMD27A; IMD27B
NCBI Protein Information
interferon gamma receptor 1
UniProt Protein Name
Interferon gamma receptor 1
UniProt Gene Name
IFNGR1
UniProt Synonym Gene Names
IFN-gamma-R-alpha
Similar Products
Product Notes
The IFNGR1 ifngr1 (Catalog #AAA46733) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-IFNGR1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNGR1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IFNGR1 ifngr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFNGR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.