Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281011_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using IFRD1 antibody.)

Rabbit IFRD1 Polyclonal Antibody | anti-IFRD1 antibody

IFRD1 Polyclonal Antibody

Gene Names
IFRD1; PC4; TIS7
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
IFRD1, Antibody; IFRD1 Polyclonal Antibody; PC4; TIS7; anti-IFRD1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSDEQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYSTLECLENIFTKSYLKEKDTTVICSTPNTVL
Sequence Length
451
Applicable Applications for anti-IFRD1 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human IFRD1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of A549 cells using IFRD1 antibody.)

product-image-AAA281011_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using IFRD1 antibody.)

WB (Western Blot)

(Western blot analysis of extracts of SW480 cells, using IFRD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA281011_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of SW480 cells, using IFRD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-IFRD1 antibody
This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development and tissue regeneration. Mutations in this gene are associated with sensory/motor neuropathy with ataxia. This gene may also be involved in modulating the pathogenesis of cystic fibrosis lung disease. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-IFRD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 45kDa; 50kDa
Observed: 47kDa
NCBI Official Full Name
interferon-related developmental regulator 1 isoform 1
NCBI Official Synonym Full Names
interferon related developmental regulator 1
NCBI Official Symbol
IFRD1
NCBI Official Synonym Symbols
PC4; TIS7
NCBI Protein Information
interferon-related developmental regulator 1
UniProt Protein Name
Interferon-related developmental regulator 1
UniProt Gene Name
IFRD1

Similar Products

Product Notes

The IFRD1 ifrd1 (Catalog #AAA281011) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFRD1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFRD1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the IFRD1 ifrd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPKNKKRNTP HRGSSAGGGG SGAAAATAAT AGGQHRNVQP FSDEDASIET MSHCSGYSDP SSFAEDGPEV LDEEGTQEDL EYKLKGLIDL TLDKSAKTRQ AALEGIKNAL ASKMLYEFIL ERRMTLTDSI ERCLKKGKSD EQRAAAALAS VLCIQLGPGI ESEEILKTLG PILKKIICDG SASMQARQTC ATCFGVCCFI ATDDITELYS TLECLENIFT KSYLKEKDTT VICSTPNTVL. It is sometimes possible for the material contained within the vial of "IFRD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.