Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281278_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 100ug extracts of HepG2 cells using 3ug IGF2BP3 antibody. Western blot was performed from the immunoprecipitate using IGF2BP3 antibody at a dilition of 1:1000.)

Rabbit anti-Human, Mouse IGF2BP3 Polyclonal Antibody | anti-IGF2BP3 antibody

IGF2BP3 Polyclonal Antibody

Gene Names
IGF2BP3; KOC; CT98; IMP3; KOC1; IMP-3; VICKZ3
Reactivity
Human, Mouse
Applications
Immunoprecipitation, Western Blot
Purity
Affinity Purification
Synonyms
IGF2BP3, Antibody; IGF2BP3 Polyclonal Antibody; CT98; IMP-3; IMP3; KOC; KOC1; VICKZ3; anti-IGF2BP3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
KKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQ
Sequence Length
579
Applicable Applications for anti-IGF2BP3 antibody
IP (Immunoprecipitation), WB (Western Blot)
Immunogen
Recombinant protein of human IGF2BP3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 100ug extracts of HepG2 cells using 3ug IGF2BP3 antibody. Western blot was performed from the immunoprecipitate using IGF2BP3 antibody at a dilition of 1:1000.)

product-image-AAA281278_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 100ug extracts of HepG2 cells using 3ug IGF2BP3 antibody. Western blot was performed from the immunoprecipitate using IGF2BP3 antibody at a dilition of 1:1000.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using IGF2BP3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)

product-image-AAA281278_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using IGF2BP3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)
Related Product Information for anti-IGF2BP3 antibody
The protein encoded by this gene is primarily found in the nucleolus, where it can bind to the 5' UTR of the insulin-like growth factor II leader 3 mRNA and may repress translation of insulin-like growth factor II during late development. The encoded protein contains several KH domains, which are important in RNA binding and are known to be involved in RNA synthesis and metabolism. A pseudogene exists on chromosome 7, and there are putative pseudogenes on other chromosomes.
Product Categories/Family for anti-IGF2BP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 21kDa; 63kDa
Observed: 70kDa
NCBI Official Full Name
insulin-like growth factor 2 mRNA-binding protein 3
NCBI Official Synonym Full Names
insulin like growth factor 2 mRNA binding protein 3
NCBI Official Symbol
IGF2BP3
NCBI Official Synonym Symbols
KOC; CT98; IMP3; KOC1; IMP-3; VICKZ3
NCBI Protein Information
insulin-like growth factor 2 mRNA-binding protein 3
UniProt Protein Name
Insulin-like growth factor 2 mRNA-binding protein 3
UniProt Gene Name
IGF2BP3
UniProt Synonym Gene Names
IMP3; KOC1; VICKZ3; IGF2 mRNA-binding protein 3; IMP-3; hKOC

Similar Products

Product Notes

The IGF2BP3 igf2bp3 (Catalog #AAA281278) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGF2BP3 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IGF2BP3 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the IGF2BP3 igf2bp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KKIEQDTDTK ITISPLQELT LYNPERTITV KGNVETCAKA EEEIMKKIRE SYENDIASMN LQAHLIPGLN LNALGLFPPT SGMPPPTSGP PSAMTPPYPQ FEQSETETVH LFIPALSVGA IIGKQGQHIK QLSRFAGASI KIAPAEAPDA KVRMVIITGP PEAQFKAQGR IYGKIKEENF VSPKEEVKLE AHIRVPSFAA GRVIGKGGKT VNELQNLSSA EVVVPRDQTP DENDQVVVKI TGHFYACQVA QRKIQ. It is sometimes possible for the material contained within the vial of "IGF2BP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.