WB (Western Blot)
(Human HepG2WB Suggested Anti-IGFBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Rabbit IGFBP2 Polyclonal Antibody | anti-IGFBP2 antibody
IGFBP2 antibody - middle region
Gene Names
IGFBP2; IBP2; IGF-BP53
Reactivity
Tested: Human; Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IGFBP2, Antibody; IGFBP2 antibody - middle region; anti-IGFBP2 antibody
Host
Rabbit
Reactivity
Tested: Human; Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-IGFBP2 antibody
WB (Western Blot)
Protein Size (# AA)
328 amino acids
Peptide Sequence
Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ
Protein Interactions
INO80B; GSDMB; TF; KLK2; IGF2; IGF1; CTNNB1;
Blocking Peptide
For anti-IGFBP2 antibody is Catalog # MBS3236557
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IGFBP2
Replacement Item
This antibody may replace item sc-120967 from Santa Cruz Biotechnology.
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 100%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Human HepG2WB Suggested Anti-IGFBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
WB (Western Blot)
(Human HepG2WB Suggested Anti-IGFBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Product Categories/Family for anti-IGFBP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
insulin-like growth factor-binding protein 2 isoform a
NCBI Official Synonym Full Names
insulin like growth factor binding protein 2
NCBI Official Symbol
IGFBP2
NCBI Official Synonym Symbols
IBP2; IGF-BP53
NCBI Protein Information
insulin-like growth factor-binding protein 2
UniProt Protein Name
Insulin-like growth factor-binding protein 2
UniProt Gene Name
IGFBP2
UniProt Synonym Gene Names
BP2; IBP2; IBP-2; IGF-binding protein 2; IGFBP-2
UniProt Entry Name
IBP2_HUMAN
Similar Products
Product Notes
The IGFBP2 igfbp2 (Catalog #AAA200356) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGFBP2 antibody - middle region reacts with Tested: Human; Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IGFBP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IGFBP2 igfbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IGFBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.