Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46496_IHC13.jpg IHC (Immunohiostchemistry) (Anti- IGFBP-3 Picoband antibody, AAA46496, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

anti-Human, Rat IGFBP3 Polyclonal Antibody | anti-IGFBP3 antibody

Anti-IGFBP3 Antibody

Average rating 0.0
No ratings yet
Gene Names
IGFBP3; IBP3; BP-53
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
IGFBP3, Antibody; Anti-IGFBP3 Antibody; Insulin-like growth factor-binding protein 3; Acid stable subunit of the 140 K IGF complex; Binding protein 29; Binding protein 53; BP 53; BP53; Growth hormone dependent binding protein; IBP 3; IBP-3; IBP3; IBP3_HUMAN; IGF binding protein 3; IGF-binding protein 3; IGFBP 3; IGFBP-3; IGFBP3; Insulin Like Growth Factor Binding Protein 3; insulin-like growth factor binding protein 3; anti-IGFBP3 antibody
Ordering
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
291
Applicable Applications for anti-IGFBP3 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- IGFBP-3 Picoband antibody, AAA46496, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46496_IHC13.jpg IHC (Immunohiostchemistry) (Anti- IGFBP-3 Picoband antibody, AAA46496, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

WB (Western Blot)

(Anti- IGFBP-3 Picoband antibody, AAA46496, Western blottingAll lanes: Anti IGFBP-3 (AAA46496) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: SGC Whole Cell Lysate at 40ugLane 4: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 31KD)

product-image-AAA46496_WB15.jpg WB (Western Blot) (Anti- IGFBP-3 Picoband antibody, AAA46496, Western blottingAll lanes: Anti IGFBP-3 (AAA46496) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: SGC Whole Cell Lysate at 40ugLane 4: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 31KD)
Related Product Information for anti-IGFBP3 antibody
Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human;Rat.

Background: IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
References
1. Lofqvist, C., Chen, J., Connor, K. M., Smith, A. C. H., Aderman, C. M., Liu, N., Pintar, J. E., Ludwig, T., Hellstrom, A., Smith, L. E. H. IGFBP3 suppresses retinopathy through suppression of oxygen-induced vessel loss and promotion of vascular regrowth.Proc. Nat. Acad. Sci. 104: 10589-10594, 2007. 2. Nwosu BU, et al. Evidence of insulin-like growth factor binding protein-3 proteolysis during growth hormone stimulation testing. J Pediatr Endocrinol Metab, 2011. 3. Relationship of insulin-like growth factor (IGF) binding protein-3 (IGFBP-3) gene polymorphism with the susceptibility to development of prostate cancer and influence on serum levels of IGF-I, and IGFBP-3. Safarinejad MR, et al. Growth Horm IGF Res, 2011 Jun.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,223 Da
NCBI Official Full Name
insulin-like growth factor-binding protein 3 isoform b
NCBI Official Synonym Full Names
insulin like growth factor binding protein 3
NCBI Official Symbol
IGFBP3
NCBI Official Synonym Symbols
IBP3; BP-53
NCBI Protein Information
insulin-like growth factor-binding protein 3
UniProt Protein Name
Insulin-like growth factor-binding protein 3
UniProt Gene Name
IGFBP3
UniProt Synonym Gene Names
IBP3; IBP-3; IGF-binding protein 3; IGFBP-3
UniProt Entry Name
IBP3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IGFBP3 igfbp3 (Catalog #AAA46496) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-IGFBP3 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IGFBP3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the IGFBP3 igfbp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IGFBP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.