Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281611_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse liver using IGHMBP2 antibody at dilution of 1:100 (40x lens).)

Rabbit IGHMBP2 Polyclonal Antibody | anti-IGHMBP2 antibody

IGHMBP2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
IGHMBP2; HCSA; HMN6; CATF1; SMARD1; SMUBP2; ZFAND7
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
IGHMBP2, Antibody; IGHMBP2 Rabbit pAb; IGHMBP2; CATF1; CMT2S; HCSA; HMN6; SMARD1; SMUBP2; ZFAND7; anti-IGHMBP2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PYNLQVDLLRQSLVHRHPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQGSSHAATKPQGPATSTRTGSQRQEGGQEAAAPARQGRKKPAGKSLASEAPSQPSLNGGSPEGV
Applicable Applications for anti-IGHMBP2 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of human IGHMBP2 (NP_002171.2).
Cellular Location
Cell projection, Cytoplasm, Nucleus, axon
Positive Samples
HepG2, A-549, Mouse brain, Mouse testis, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse liver using IGHMBP2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281611_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse liver using IGHMBP2 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human mammary cancer using IGHMBP2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281611_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human mammary cancer using IGHMBP2 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human lung cancer using IGHMBP2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281611_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human lung cancer using IGHMBP2 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat brain using IGHMBP2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281611_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat brain using IGHMBP2 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using IGHMBP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA281611_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using IGHMBP2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-IGHMBP2 antibody
Background: This gene encodes a helicase superfamily member that binds a specific DNA sequence from the immunoglobulin mu chain switch region. Mutations in this gene lead to spinal muscle atrophy with respiratory distress type 1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109,149 Da
NCBI Official Full Name
DNA-binding protein SMUBP-2
NCBI Official Synonym Full Names
immunoglobulin mu binding protein 2
NCBI Official Symbol
IGHMBP2
NCBI Official Synonym Symbols
HCSA; HMN6; CATF1; SMARD1; SMUBP2; ZFAND7
NCBI Protein Information
DNA-binding protein SMUBP-2; GF-1; glial factor 1; ATP-dependent helicase IGHMBP2; cardiac transcription factor 1; zinc finger, AN1-type domain 7; immunoglobulin mu-binding protein 2
UniProt Protein Name
DNA-binding protein SMUBP-2
UniProt Gene Name
IGHMBP2
UniProt Synonym Gene Names
SMBP2; SMUBP2; GF-1
UniProt Entry Name
SMBP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IGHMBP2 ighmbp2 (Catalog #AAA281611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGHMBP2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IGHMBP2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the IGHMBP2 ighmbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PYNLQVDLLR QSLVHRHPEL EIKSVDGFQG REKEAVILSF VRSNRKGEVG FLAEDRRINV AVTRARRHVA VICDSRTVNN HAFLKTLVEY FTQHGEVRTA FEYLDDIVPE NYSHENSQGS SHAATKPQGP ATSTRTGSQR QEGGQEAAAP ARQGRKKPAG KSLASEAPSQ PSLNGGSPEG V. It is sometimes possible for the material contained within the vial of "IGHMBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.