WB (Western Blot)
(WB Suggested Anti-IKZF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateIKZF4 is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit IKZF4 Polyclonal Antibody | anti-IKZF4 antibody
IKZF4 antibody - N-terminal region
Gene Names
IKZF4; EOS; ZNFN1A4
Reactivity
Human, Mouse, Pig
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
IKZF4, Antibody; IKZF4 antibody - N-terminal region; anti-IKZF4 antibody
Host
Rabbit
Reactivity
Human, Mouse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKE
Sequence Length
585
Applicable Applications for anti-IKZF4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%; Mouse: 100%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of human IKZF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-IKZF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateIKZF4 is supported by BioGPS gene expression data to be expressed in 721_B)
WB (Western Blot)
(WB Suggested Anti-IKZF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateIKZF4 is supported by BioGPS gene expression data to be expressed in 721_B)
IHC (Immunohistochemistry)
(Rabbit Anti-IKZF4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: NuclearPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
IHC (Immunohistochemistry)
(Rabbit Anti-IKZF4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: NuclearPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-IKZF4 antibody
This is a rabbit polyclonal antibody against IKZF4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-436 AC034102.32 139959-140394 c 437-975 DA797441.1 1-539 976-5506 BX647761.1 546-5076
Target Description: Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-436 AC034102.32 139959-140394 c 437-975 DA797441.1 1-539 976-5506 BX647761.1 546-5076
Product Categories/Family for anti-IKZF4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
zinc finger protein Eos isoform a
NCBI Official Synonym Full Names
IKAROS family zinc finger 4
NCBI Official Symbol
IKZF4
NCBI Official Synonym Symbols
EOS; ZNFN1A4
NCBI Protein Information
zinc finger protein Eos
UniProt Protein Name
Zinc finger protein Eos
UniProt Gene Name
IKZF4
UniProt Synonym Gene Names
KIAA1782; ZNFN1A4
UniProt Entry Name
IKZF4_HUMAN
Similar Products
Product Notes
The IKZF4 ikzf4 (Catalog #AAA198503) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IKZF4 antibody - N-terminal region reacts with Human, Mouse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's IKZF4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the IKZF4 ikzf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSHRQGKDNL ERDPSGGCVP DFLPQAQDSN HFIMESLFCE SSGDSSLEKE. It is sometimes possible for the material contained within the vial of "IKZF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.