Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201196_WB13.jpg WB (Western Blot) (WB Suggested Anti-IL13RA1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

Rabbit IL13RA1 Polyclonal Antibody | anti-IL13RA1 antibody

IL13RA1 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
IL13RA1; NR4; CT19; CD213A1; IL-13Ra
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL13RA1, Antibody; IL13RA1 Antibody - N-terminal region; anti-IL13RA1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP
Sequence Length
427
Applicable Applications for anti-IL13RA1 antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 85%; Guinea Pig: 77%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 100%; Rat: 86%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of IL13RA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IL13RA1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

product-image-AAA201196_WB13.jpg WB (Western Blot) (WB Suggested Anti-IL13RA1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

WB (Western Blot)

(Sample Type :Lane 1: 60ug mouse CT26 lysate Lane 2: 60ug mouse MC38 lysate Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:5000 Color/Signal Descriptions:IL13RA1 Gene Name:Miranda A. Hallett, Vanderbilt University Medical Center Submitted by:)

product-image-AAA201196_WB15.jpg WB (Western Blot) (Sample Type :Lane 1: 60ug mouse CT26 lysate Lane 2: 60ug mouse MC38 lysate Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:5000 Color/Signal Descriptions:IL13RA1 Gene Name:Miranda A. Hallett, Vanderbilt University Medical Center Submitted by:)
Related Product Information for anti-IL13RA1 antibody
This is a rabbit polyclonal antibody against IL13RA1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.
Product Categories/Family for anti-IL13RA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
interleukin-13 receptor subunit alpha-1
NCBI Official Synonym Full Names
interleukin 13 receptor subunit alpha 1
NCBI Official Symbol
IL13RA1
NCBI Official Synonym Symbols
NR4; CT19; CD213A1; IL-13Ra
NCBI Protein Information
interleukin-13 receptor subunit alpha-1
UniProt Protein Name
Interleukin-13 receptor subunit alpha-1
UniProt Gene Name
IL13RA1
UniProt Synonym Gene Names
IL13R; IL13RA; IL-13 receptor subunit alpha-1; IL-13R subunit alpha-1; IL-13R-alpha-1; IL-13RA1; CT19
UniProt Entry Name
I13R1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL13RA1 il13ra1 (Catalog #AAA201196) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL13RA1 Antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IL13RA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IL13RA1 il13ra1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSVENLCTVI WTWNPPEGAS SNCSLWYFSH FGDKQDKKIA PETRRSIEVP. It is sometimes possible for the material contained within the vial of "IL13RA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.