Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201306_WB11.jpg WB (Western Blot) (WB Suggested Anti-IL26 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Rabbit anti-Dog, Human IL26 Polyclonal Antibody | anti-IL26 antibody

IL26 antibody - N-terminal region

Gene Names
IL26; AK155; IL-26
Reactivity
Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL26, Antibody; IL26 antibody - N-terminal region; anti-IL26 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK
Sequence Length
171
Applicable Applications for anti-IL26 antibody
WB (Western Blot)
Homology
Dog: 100%; Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IL26 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

product-image-AAA201306_WB11.jpg WB (Western Blot) (WB Suggested Anti-IL26 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: IL26Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201306_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: IL26Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: IL26Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201306_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: IL26Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-IL26 antibody
This is a rabbit polyclonal antibody against IL26. It was validated on Western Blot

Target Description: This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to contribute to the transformed phenotype of T cells after infection by herpesvirus samimiri.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
interleukin-26
NCBI Official Synonym Full Names
interleukin 26
NCBI Official Symbol
IL26
NCBI Official Synonym Symbols
AK155; IL-26
NCBI Protein Information
interleukin-26
UniProt Protein Name
Interleukin-26
UniProt Gene Name
IL26
UniProt Synonym Gene Names
AK155; IL-26

Similar Products

Product Notes

The IL26 il26 (Catalog #AAA201306) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL26 antibody - N-terminal region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL26 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IL26 il26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVTLSLAIAK HKQSSFTKSC YPRGTLSQAV DALYIKAAWL KATIPEDRIK. It is sometimes possible for the material contained within the vial of "IL26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.