Rabbit IL28B Polyclonal Antibody | anti-IFNL3 antibody
IL28B antibody - C-terminal region
Gene Names
IFNL3; IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL28B, Antibody; IL28B antibody - C-terminal region; anti-IFNL3 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Specificity
This antibody is pan-IL28 specific, as there is 100% homology to the human IL28A sequence, per http://www.uniprot.org/uniprot/Q8IZJ0.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDL
Sequence Length
196
Applicable Applications for anti-IFNL3 antibody
WB (Western Blot)
Homology
Dog: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 85%; Rat: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-IFNL3 antibody
This is a rabbit polyclonal antibody against IL28B. It was validated on Western Blot
Target Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
Target Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
Product Categories/Family for anti-IFNL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
interferon lambda-3 isoform 2
NCBI Official Synonym Full Names
interferon lambda 3
NCBI Official Symbol
IFNL3
NCBI Official Synonym Symbols
IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4
NCBI Protein Information
interferon lambda-3
UniProt Protein Name
Interferon lambda-3
UniProt Gene Name
IFNL3
UniProt Synonym Gene Names
IL28B; IL28C; ZCYTO22; IFN-lambda-3; IL-28B; IL-28C
UniProt Entry Name
IFNL3_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The IFNL3 ifnl3 (Catalog #AAA201229) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL28B antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IL28B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IFNL3 ifnl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRTRGRLHHW LHRLQEAPKK ESPGCLEASV TFNLFRLLTR DLNCVASGDL. It is sometimes possible for the material contained within the vial of "IL28B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
