Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201171_WB11.jpg WB (Western Blot) (WB Suggested Anti-IL6ST AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

Rabbit IL6ST Polyclonal Antibody | anti-IL6ST antibody

IL6ST antibody - middle region

Gene Names
IL6ST; CD130; GP130; CDW130; IL-6RB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
IL6ST, Antibody; IL6ST antibody - middle region; anti-IL6ST antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKV
Sequence Length
329
Applicable Applications for anti-IL6ST antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 77%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IL6ST AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

product-image-AAA201171_WB11.jpg WB (Western Blot) (WB Suggested Anti-IL6ST AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

IHC (Immunohiostchemistry)

(Rabbit Anti-IL6ST AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid TissueObserved Staining: Plasma membrane and cytoplasm in follicular cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201171_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-IL6ST AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid TissueObserved Staining: Plasma membrane and cytoplasm in follicular cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-IL6ST AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201171_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-IL6ST AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-IL6ST antibody
This is a rabbit polyclonal antibody against IL6ST. It was validated on Western Blot

Target Description: The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggest that this gene plays a critical role in regulating myocyte apoptosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
interleukin-6 receptor subunit beta isoform 2
NCBI Official Synonym Full Names
interleukin 6 signal transducer
NCBI Official Symbol
IL6ST
NCBI Official Synonym Symbols
CD130; GP130; CDW130; IL-6RB
NCBI Protein Information
interleukin-6 receptor subunit beta
UniProt Protein Name
Interleukin-6 receptor subunit beta
UniProt Gene Name
IL6ST
UniProt Synonym Gene Names
IL-6 receptor subunit beta; IL-6R subunit beta; IL-6R-beta; IL-6RB; gp130
UniProt Entry Name
IL6RB_HUMAN

Similar Products

Product Notes

The IL6ST il6st (Catalog #AAA201171) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL6ST antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IL6ST can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the IL6ST il6st for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTLKSEWATH KFADCKAKRD TPTSCTVDYS TVYFVNIEVW VEAENALGKV. It is sometimes possible for the material contained within the vial of "IL6ST, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.