Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198015_WB8.jpg WB (Western Blot) (WB Suggested Anti-ILF2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit ILF2 Polyclonal Antibody | anti-ILF2 antibody

ILF2 antibody - C-terminal region

Gene Names
ILF2; NF45; PRO3063
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
ILF2, Antibody; ILF2 antibody - C-terminal region; anti-ILF2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE
Sequence Length
390
Applicable Applications for anti-ILF2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ILF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ILF2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

product-image-AAA198015_WB8.jpg WB (Western Blot) (WB Suggested Anti-ILF2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: ILF2Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

product-image-AAA198015_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: ILF2Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

WB (Western Blot)

(Sample Type: Human MCF-7Sample Type: MCF-7 WT a whole cell lysates (110UG)Primary Dilution: 1.5mg/mLSecondary Antibody: LI-COR Donkey anti-rabbitSecondary Dilution: 1:10,000ILF2 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA198015_WB11.jpg WB (Western Blot) (Sample Type: Human MCF-7Sample Type: MCF-7 WT a whole cell lysates (110UG)Primary Dilution: 1.5mg/mLSecondary Antibody: LI-COR Donkey anti-rabbitSecondary Dilution: 1:10,000ILF2 is supported by BioGPS gene expression data to be expressed in MCF7)

IHC (Immunohiostchemistry)

(Rabbit Anti-ILF2 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198015_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-ILF2 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA198015_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-ILF2 antibody
This is a rabbit polyclonal antibody against ILF2. It was validated on Western Blot and immunohistochemistry

Target Description: Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of the ILF2 gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
interleukin enhancer-binding factor 2 isoform 1
NCBI Official Synonym Full Names
interleukin enhancer binding factor 2
NCBI Official Symbol
ILF2
NCBI Official Synonym Symbols
NF45; PRO3063
NCBI Protein Information
interleukin enhancer-binding factor 2
UniProt Protein Name
Interleukin enhancer-binding factor 2
UniProt Gene Name
ILF2
UniProt Synonym Gene Names
NF45
UniProt Entry Name
ILF2_HUMAN

Similar Products

Product Notes

The ILF2 ilf2 (Catalog #AAA198015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ILF2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ILF2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ILF2 ilf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HGGFRKILGQ EGDASYLASE ISTWDGVIVT PSEKAYEKPP EKKEGEEEEE. It is sometimes possible for the material contained within the vial of "ILF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.