Rabbit Influenza Virus Ns1A Binding Polyclonal Antibody
Influenza Virus Ns1A Binding Protein antibody
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
Influenza Virus Ns1A Binding, Antibody; Influenza Virus Ns1A Binding Protein antibody; Polyclonal Influenza Virus Ns1A Binding Protein; Anti-Influenza Virus Ns1A Binding Protein; Swine Flu; Influenza A nuclear; Flu A; Influenza Ns1A Binding Protein; H1N1; Influenza ABP; Flu A H1N1; IVNS1ABP; anti-Influenza Virus Ns1A Binding antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
Influenza Virus Ns1A Binding Protein antibody was raised against the N terminal of IVNS1ABP
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IVNS1ABP antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-Influenza Virus Ns1A Binding antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.
Cross-Reactivity
Human, Dog
Immunogen
Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-Influenza Virus Ns1A Binding antibody
Rabbit polyclonal Influenza Virus Ns1A Binding Protein antibody raised against the N terminal of IVNS1ABP
Product Categories/Family for anti-Influenza Virus Ns1A Binding antibody
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Influenza Virus Ns1A Binding (Catalog #AAA224342) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Influenza Virus Ns1A Binding can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Influenza Virus Ns1A Binding for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Influenza Virus Ns1A Binding, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
