Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200095_WB13.jpg WB (Western Blot) (WB Suggested Anti-ING1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that ING1 is expressed in HepG2)

Rabbit ING1 Polyclonal Antibody | anti-ING1 antibody

ING1 antibody - C-terminal region

Gene Names
ING1; p33; p47; p33ING1; p24ING1c; p33ING1b; p47ING1a
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
ING1, Antibody; ING1 antibody - C-terminal region; anti-ING1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD
Sequence Length
279
Applicable Applications for anti-ING1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ING1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ING1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that ING1 is expressed in HepG2)

product-image-AAA200095_WB13.jpg WB (Western Blot) (WB Suggested Anti-ING1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that ING1 is expressed in HepG2)

WB (Western Blot)

(Lanes:1: 30ug HeLa lysate, 2: 30ug HFF lysate, 3: 30ug U2OS lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:ING1Submitted by:Dr. Hyung Suk Oh, Knipe Lab, Harvard Medical School)

product-image-AAA200095_WB15.jpg WB (Western Blot) (Lanes:1: 30ug HeLa lysate, 2: 30ug HFF lysate, 3: 30ug U2OS lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:ING1Submitted by:Dr. Hyung Suk Oh, Knipe Lab, Harvard Medical School)
Related Product Information for anti-ING1 antibody
This is a rabbit polyclonal antibody against ING1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ING1 is a tumor suppressor protein that can induce cell growth arrest and apoptosis. The protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of ING1 gene have been detected in various cancers.This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
inhibitor of growth protein 1 isoform A
NCBI Official Synonym Full Names
inhibitor of growth family member 1
NCBI Official Symbol
ING1
NCBI Official Synonym Symbols
p33; p47; p33ING1; p24ING1c; p33ING1b; p47ING1a
NCBI Protein Information
inhibitor of growth protein 1
UniProt Protein Name
Inhibitor of growth family, member 1
UniProt Gene Name
ING1
UniProt Entry Name
Q5T9H0_HUMAN

Similar Products

Product Notes

The ING1 ing1 (Catalog #AAA200095) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ING1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ING1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ING1 ing1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKKAKTSKKK KRSKAKAERE ASPADLPIDP NEPTYCLCNQ VSYGEMIGCD. It is sometimes possible for the material contained within the vial of "ING1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.