Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282383_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and IRF9 knockout (KO) A549 cells, using IRF9 Rabbit pAb (AAA282383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

Rabbit anti-Human IRF9 Polyclonal Antibody | anti-IRF9 antibody

IRF9 Rabbit pAb

Gene Names
IRF9; p48; IRF-9; ISGF3; ISGF3G
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
IRF9, Antibody; IRF9 Rabbit pAb; p48; IRF-9; ISGF3; ISGF3G; anti-IRF9 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
QLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSME
Applicable Applications for anti-IRF9 antibody
WB (Western Blot)
Positive Samples
A549
Cellular Location
Cytoplasm, Nucleus
Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 113-255 of human IRF9 (NP_006075.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and IRF9 knockout (KO) A549 cells, using IRF9 Rabbit pAb (AAA282383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

product-image-AAA282383_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and IRF9 knockout (KO) A549 cells, using IRF9 Rabbit pAb (AAA282383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using IRF9 antibody (AAA282383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)

product-image-AAA282383_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using IRF9 antibody (AAA282383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)
Related Product Information for anti-IRF9 antibody
This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65.
Product Categories/Family for anti-IRF9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
393
NCBI Official Full Name
Interferon regulatory factor 9
NCBI Official Synonym Full Names
interferon regulatory factor 9
NCBI Official Symbol
IRF9
NCBI Official Synonym Symbols
p48; IRF-9; ISGF3; ISGF3G
NCBI Protein Information
interferon regulatory factor 9; ISGF-3 gamma; ISGF3 p48 subunit; interferon-stimulated gene factor 3 gamma; transcriptional regulator ISGF3 subunit gamma; IFN-alpha-responsive transcription factor subunit; interferon-stimulated transcription factor 3, gam
UniProt Protein Name
Interferon regulatory factor 9
UniProt Gene Name
IRF9
UniProt Synonym Gene Names
ISGF3G; IRF-9; ISGF-3 gamma
UniProt Entry Name
IRF9_HUMAN

Similar Products

Product Notes

The IRF9 irf9 (Catalog #AAA282383) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IRF9 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IRF9 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IRF9 irf9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QLLPPGIVSG QPGTQKVPSK RQHSSVSSER KEEEDAMQNC TLSPSVLQDS LNNEEEGASG GAVHSDIGSS SSSSSPEPQE VTDTTEAPFQ GDQRSLEFLL PPEPDYSLLL TFIYNGRVVG EAQVQSLDCR LVAEPSGSES SME. It is sometimes possible for the material contained within the vial of "IRF9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.