Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46535_WB8.jpg WB (Western Blot) (Western blot analysis of ITGA2B using anti- ITGA2B antibody (PB9647).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HEK293 whole cell lysates,Lane 2: human HepG2 whole cell lysates,After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)

ITGA2B Polyclonal Antibody | anti-ITGA2B antibody

Anti-ITGA2B Antibody

Gene Names
ITGA2B; GT; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93
Reactivity
Human, Mouse, Rat
Purity
Immunogen Affinity Purified
Synonyms
ITGA2B, Antibody; Anti-ITGA2B Antibody; Integrin alpha-Iib; antigen CD41; BDPLT16; BDPLT2; CD41; CD41B; form 2; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; Integrin alpha 2b; Integrin alpha IIb; Integrin alpha-IIb light chain; Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITA2B_HUMAN; ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet specific antigen BAK; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); anti-ITGA2B antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1039
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Western blot analysis of ITGA2B using anti- ITGA2B antibody (PB9647).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HEK293 whole cell lysates,Lane 2: human HepG2 whole cell lysates,After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)

product-image-AAA46535_WB8.jpg WB (Western Blot) (Western blot analysis of ITGA2B using anti- ITGA2B antibody (PB9647).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HEK293 whole cell lysates,Lane 2: human HepG2 whole cell lysates,After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)

IHC (Immunohistochemistry)

(Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Human Mammary Cancer Tissue)

product-image-AAA46535_IHC10.jpg IHC (Immunohistochemistry) (Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Human Mammary Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Rat Lung Tissue)

product-image-AAA46535_IHC11.jpg IHC (Immunohistochemisry) (Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Rat Lung Tissue)

Application Data

(Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Mouse Lung Tissue)

product-image-AAA46535_AD13.jpg Application Data (Anti- ITGA2B Picoband antibody, PB9647, IHC(P)IHC(P): Mouse Lung Tissue)

WB (Western Blot)

(Western blot analysis of ITGA2B using anti- ITGA2B antibodyElectrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat spleen tissue lysates,Lane 2: mouse spleen tissue lysates,After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)

product-image-AAA46535_WB15.jpg WB (Western Blot) (Western blot analysis of ITGA2B using anti- ITGA2B antibodyElectrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat spleen tissue lysates,Lane 2: mouse spleen tissue lysates,After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.)
Related Product Information for anti-ITGA2B antibody
Description: Rabbit IgG polyclonal antibody for Integrin alpha-Iib(ITGA2B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.
References
1. "Entrez Gene: ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)". 2. Naik UP, Parise LV (1997). "Structure and function of platelet alpha IIb beta 3.". Curr. Opin. Hematol. 4(5): 317-22. 3. Quinn MJ, Byzova TV, Qin J et al. (2004). "Integrin alphaIIbbeta3 and its antagonism.". Arterioscler. Thromb. Vasc. Biol. 23 (6): 945-52.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
integrin alpha-IIb preproprotein
NCBI Official Synonym Full Names
integrin subunit alpha 2b
NCBI Official Symbol
ITGA2B
NCBI Official Synonym Symbols
GT; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93
NCBI Protein Information
integrin alpha-IIb
UniProt Protein Name
Integrin alpha-IIb
UniProt Gene Name
ITGA2B
UniProt Synonym Gene Names
GP2B; ITGAB; GPIIb
UniProt Entry Name
ITA2B_HUMAN

Similar Products

Product Notes

The ITGA2B itga2b (Catalog #AAA46535) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ITGA2B Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. It is sometimes possible for the material contained within the vial of "ITGA2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.