Rabbit Itgb1 Polyclonal Antibody | anti-ITGB1 antibody
Itgb1 antibody - C-terminal region
Gene Names
Itgb1; CD29; Fnrb; gpIIa; Gm9863; AA409975; AA960159; 4633401G24Rik
Reactivity
Tested: Human, MousePredicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
Itgb1, Antibody; Itgb1 antibody - C-terminal region; anti-ITGB1 antibody
Host
Rabbit
Reactivity
Tested: Human, Mouse
Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD
Sequence Length
798
Applicable Applications for anti-ITGB1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Predicted Size (#AA)
798 Amino Acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ITGB1 antibody
This is a rabbit polyclonal antibody against Itgb1. It was validated on Western Blot
Target Description: Itgb1 plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis.
Target Description: Itgb1 plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis.
Product Categories/Family for anti-ITGB1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
integrin beta-1
NCBI Official Synonym Full Names
integrin beta 1 (fibronectin receptor beta)
NCBI Official Symbol
Itgb1
NCBI Official Synonym Symbols
CD29; Fnrb; gpIIa; Gm9863; AA409975; AA960159; 4633401G24Rik
NCBI Protein Information
integrin beta-1
UniProt Protein Name
Integrin beta-1
UniProt Gene Name
Itgb1
UniProt Entry Name
ITB1_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ITGB1 itgb1 (Catalog #AAA200864) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Itgb1 antibody - C-terminal region reacts with Tested: Human, Mouse Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Itgb1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ITGB1 itgb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDIIPIVAGV VAGIVLIGLA LLLIWKLLMI IHDRREFAKF EKEKMNAKWD. It is sometimes possible for the material contained within the vial of "Itgb1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
