Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282340_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse kidney using ITPR2 antibody at dilution of 1:100 (40x lens).)

Rabbit ITPR2 Polyclonal Antibody | anti-ITPR2 antibody

ITPR2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
PSRC1; DDA3; FP3214
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry
Purity
Affinity purification
Synonyms
ITPR2, Antibody; ITPR2 Rabbit pAb; ANHD; CFAP48; INSP3R2; IP3R2; ITPR2; anti-ITPR2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASEET
Applicable Applications for anti-ITPR2 antibody
IHC (Immunohistochemistry)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2415-2480 of human ITPR2 (NP_002214.2).
Cellular Location
cell cortex, endoplasmic reticulum, nucleoplasm, plasma membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse kidney using ITPR2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA282340_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse kidney using ITPR2 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human liver using ITPR2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA282340_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human liver using ITPR2 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat lung using ITPR2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA282340_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using ITPR2 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-ITPR2 antibody
The protein encoded by this gene belongs to the inositol 1, 4, 5-triphosphate receptor family, whose members are second messenger intracellular calcium release channels. These proteins mediate a rise in cytoplasmic calcium in response to receptor activated production of inositol triphosphate. Inositol triphosphate receptor-mediated signaling is involved in many processes including cell migration, cell division, smooth muscle contraction, and neuronal signaling. This protein is a type 2 receptor that consists of a cytoplasmic amino-terminus that binds inositol triphosphate, six membrane-spanning helices that contribute to the ion pore, and a short cytoplasmic carboxy-terminus. A mutation in this gene has been associated with anhidrosis, suggesting that intracellular calcium release mediated by this protein is required for eccrine sweat production. [provided by RefSeq, Apr 2015]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,632 Da
NCBI Official Full Name
proline/serine-rich coiled-coil protein 1 isoform a
NCBI Official Synonym Full Names
proline and serine rich coiled-coil 1
NCBI Official Symbol
PSRC1
NCBI Official Synonym Symbols
DDA3; FP3214
NCBI Protein Information
proline/serine-rich coiled-coil protein 1
UniProt Protein Name
Proline/serine-rich coiled-coil protein 1
UniProt Gene Name
PSRC1
UniProt Synonym Gene Names
DDA3

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ITPR2 psrc1 (Catalog #AAA282340) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITPR2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ITPR2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ITPR2 psrc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEDLEEDVRF IVDETLDFGG LSPSDSREEE DITVLVTPEK PLRRGLSHRS DPNAVAPAPQ GVRLSLGPLS PEKLEEILDE ANRLAAQLEQ CALQDRESAG EGLGPRRVKP SPRRETFVLK DSPVRDLLPT VNSLTRSTPS PSSLTPRLRS NDRKGSVRAL RATSGKRPSN MKRESPTCNL FPASKSPASS PLTRSTPPVR GRAGPSGRAA ASEET. It is sometimes possible for the material contained within the vial of "ITPR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.