Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197524_WB13.jpg WB (Western Blot) (WB Suggested Anti-IVNS1ABP Antibody Titration: 0.2-1 ug/mlPositive Control: K562 cell lysate)

Rabbit IVNS1ABP Polyclonal Antibody | anti-IVNS1ABP antibody

IVNS1ABP antibody - N-terminal region

Gene Names
IVNS1ABP; ND1; ARA3; NS-1; NS1BP; FLARA3; KLHL39; NS1-BP; HSPC068
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
IVNS1ABP, Antibody; IVNS1ABP antibody - N-terminal region; anti-IVNS1ABP antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
Sequence Length
642
Applicable Applications for anti-IVNS1ABP antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IVNS1ABP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IVNS1ABP Antibody Titration: 0.2-1 ug/mlPositive Control: K562 cell lysate)

product-image-AAA197524_WB13.jpg WB (Western Blot) (WB Suggested Anti-IVNS1ABP Antibody Titration: 0.2-1 ug/mlPositive Control: K562 cell lysate)

IHC (Immunohistochemistry)

(Human Liver)

product-image-AAA197524_IHC15.jpg IHC (Immunohistochemistry) (Human Liver)
Related Product Information for anti-IVNS1ABP antibody
This is a rabbit polyclonal antibody against IVNS1ABP. It was validated on Western Blot and immunohistochemistry

Target Description: This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
influenza virus NS1A-binding protein
NCBI Official Synonym Full Names
influenza virus NS1A binding protein
NCBI Official Symbol
IVNS1ABP
NCBI Official Synonym Symbols
ND1; ARA3; NS-1; NS1BP; FLARA3; KLHL39; NS1-BP; HSPC068
NCBI Protein Information
influenza virus NS1A-binding protein
UniProt Protein Name
Influenza virus NS1A-binding protein
UniProt Gene Name
IVNS1ABP
UniProt Synonym Gene Names
ARA3; FLARA3; KIAA0850; NS1; NS1BP; NS1-BP; NS1-binding protein
UniProt Entry Name
NS1BP_HUMAN

Similar Products

Product Notes

The IVNS1ABP ivns1abp (Catalog #AAA197524) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IVNS1ABP antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's IVNS1ABP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the IVNS1ABP ivns1abp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RAVLACCSPY LFEIFNSDSD PHGISHVKFD DLNPEAVEVL LNYAYTAQLK. It is sometimes possible for the material contained within the vial of "IVNS1ABP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.