Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197779_WB13.jpg WB (Western Blot) (WB Suggested Anti-PHF16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit JADE3 Polyclonal Antibody | anti-JADE3 antibody

JADE3 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
JADE3; PHF16; JADE-3
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
JADE3, Antibody; JADE3 Antibody - middle region; anti-JADE3 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: KSYCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFY
Applicable Applications for anti-JADE3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 92%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PHF16
Protein Size (# AA)
823 amino acids
Protein Interactions
MAGEA11; UBC; HIST3H3; ELAVL1; ING5; ING4; KAT7
Blocking Peptide
For anti-JADE3 (MBS3201992) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PHF16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

product-image-AAA197779_WB13.jpg WB (Western Blot) (WB Suggested Anti-PHF16 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

IHC (Immunohistochemistry)

(Rabbit Anti-PHF16 AntibodyParaffin Embedded Tissue: Human bronchiole epitheliumCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197779_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PHF16 AntibodyParaffin Embedded Tissue: Human bronchiole epitheliumCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-JADE3 antibody
This is a rabbit polyclonal antibody against PHF16. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of a family of large proteins containing PHD (plant homeo domain)-type zinc fingers. The encoded protein may be associated in a nuclear complex that functions in histone H4 acetylation. Alternative splicing results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-JADE3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
protein Jade-3
NCBI Official Synonym Full Names
jade family PHD finger 3
NCBI Official Symbol
JADE3
NCBI Official Synonym Symbols
PHF16; JADE-3
NCBI Protein Information
protein Jade-3
UniProt Protein Name
Protein Jade-3
UniProt Gene Name
JADE3
UniProt Synonym Gene Names
KIAA0215; PHF16
UniProt Entry Name
JADE3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The JADE3 jade3 (Catalog #AAA197779) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JADE3 Antibody - middle region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's JADE3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the JADE3 jade3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KSYCLKHSQN RQKLGEAEYP HHRAKEQSQA KSEKTSLRAQ KLRELEEEFY. It is sometimes possible for the material contained within the vial of "JADE3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.