WB (Western Blot)
(WB Suggested Anti-JUN Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateJUN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Rabbit JUN Polyclonal Antibody | anti-JUN antibody
JUN antibody - N-terminal region
Gene Names
JUN; AP1; p39; AP-1; c-Jun
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
JUN, Antibody; JUN antibody - N-terminal region; anti-JUN antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLK
Sequence Length
331
Applicable Applications for anti-JUN antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human JUN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-JUN Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateJUN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
WB (Western Blot)
(WB Suggested Anti-JUN Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateJUN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
WB (Western Blot)
(Host: MouseTarget Name: JUNSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: JUNSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-JUN antibody
This is a rabbit polyclonal antibody against JUN. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Target Description: JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Product Categories/Family for anti-JUN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
transcription factor AP-1
NCBI Official Synonym Full Names
Jun proto-oncogene, AP-1 transcription factor subunit
NCBI Official Symbol
JUN
NCBI Official Synonym Symbols
AP1; p39; AP-1; c-Jun
NCBI Protein Information
transcription factor AP-1
UniProt Protein Name
Transcription factor AP-1
UniProt Gene Name
JUN
UniProt Synonym Gene Names
AP1
UniProt Entry Name
JUN_HUMAN
Similar Products
Product Notes
The JUN jun (Catalog #AAA198245) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JUN antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's JUN can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the JUN jun for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTAKMETTFY DDALNASFLP SESGPYGYSN PKILKQSMTL NLADPVGSLK. It is sometimes possible for the material contained within the vial of "JUN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.