<
WB (Western Blot)
(WB Suggested Anti-KAT5 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellThere is BioGPS gene expression data showing that KAT5 is expressed in HT1080)
Rabbit KAT5 Polyclonal Antibody | anti-KAT5 antibody
KAT5 antibody - C-terminal region
Gene Names
KAT5; TIP; ESA1; PLIP; TIP60; cPLA2; HTATIP; ZC2HC5; HTATIP1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
KAT5, Antibody; KAT5 antibody - C-terminal region; anti-KAT5 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWS
Sequence Length
461
Applicable Applications for anti-KAT5 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-KAT5 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellThere is BioGPS gene expression data showing that KAT5 is expressed in HT1080)
WB (Western Blot)
(WB Suggested Anti-KAT5 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellThere is BioGPS gene expression data showing that KAT5 is expressed in HT1080)
WB (Western Blot)
(WB Suggested Anti-KAT5 AntibodyPositive Control: Lane 1: 50ug human RKO lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Goat anti-rabbit-Alexa Fluor 680Secondry Antibody Dilution : 1:5000Submitted by: Dr. Syed Morshed)
WB (Western Blot)
(WB Suggested Anti-KAT5 AntibodyPositive Control: Lane 1: 50ug human RKO lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Goat anti-rabbit-Alexa Fluor 680Secondry Antibody Dilution : 1:5000Submitted by: Dr. Syed Morshed)
IHC (Immunohiostchemistry)
(Rabbit Anti-KAT5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm in Leydig cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohiostchemistry)
(Rabbit Anti-KAT5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm in Leydig cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-KAT5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-KAT5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-KAT5 antibody
This is a rabbit polyclonal antibody against KAT5. It was validated on Western Blot
Target Description: The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.
Target Description: The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.
Product Categories/Family for anti-KAT5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
histone acetyltransferase KAT5 isoform 3
NCBI Official Synonym Full Names
lysine acetyltransferase 5
NCBI Official Symbol
KAT5
NCBI Official Synonym Symbols
TIP; ESA1; PLIP; TIP60; cPLA2; HTATIP; ZC2HC5; HTATIP1
NCBI Protein Information
histone acetyltransferase KAT5
UniProt Protein Name
Histone acetyltransferase KAT5
UniProt Gene Name
KAT5
UniProt Synonym Gene Names
HTATIP; TIP60; Tip60
UniProt Entry Name
KAT5_HUMAN
Similar Products
Product Notes
The KAT5 kat5 (Catalog #AAA198391) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KAT5 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KAT5 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the KAT5 kat5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQYLNLINYY KGQYILTLSE DIVDGHERAM LKRLLRIDSK CLHFTPKDWS. It is sometimes possible for the material contained within the vial of "KAT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.