WB (Western Blot)
(WB Suggested Anti-KCNA10 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Rabbit KCNA10 Polyclonal Antibody | anti-KCNA10 antibody
KCNA10 antibody - middle region
Gene Names
KCNA10; Kcn1; Kv1.8
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
KCNA10, Antibody; KCNA10 antibody - middle region; anti-KCNA10 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW
Sequence Length
511
Applicable Applications for anti-KCNA10 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNA10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-KCNA10 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-KCNA10 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-KCNA10 antibody
This is a rabbit polyclonal antibody against KCNA10. It was validated on Western Blot and immunohistochemistry
Target Description: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.
Target Description: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.
Product Categories/Family for anti-KCNA10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 10
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily A member 10
NCBI Official Symbol
KCNA10
NCBI Official Synonym Symbols
Kcn1; Kv1.8
NCBI Protein Information
potassium voltage-gated channel subfamily A member 10
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 10
UniProt Gene Name
KCNA10
Similar Products
Product Notes
The KCNA10 kcna10 (Catalog #AAA197934) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNA10 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNA10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KCNA10 kcna10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PANVPIDIFA DEISFYELGS EAMDQFREDE GFIKDPETLL PTNDIHRQFW. It is sometimes possible for the material contained within the vial of "KCNA10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.