Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197984_WB8.jpg WB (Western Blot) (WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateKCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit KCNIP2 Polyclonal Antibody | anti-KCNIP2 antibody

KCNIP2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KCNIP2; KCHIP2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNIP2, Antibody; KCNIP2 antibody - N-terminal region; anti-KCNIP2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKE
Sequence Length
285
Applicable Applications for anti-KCNIP2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateKCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA197984_WB8.jpg WB (Western Blot) (WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateKCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Lanes:Lane 1: 20ug HEK-293 cell lysateLane 2: 20ug mkchIP2-YFP transfected HEK-293 lysateLane 3: 20ug mkchIP3-YFP transfected HEK-293 lysateLane 4: 20ug mkchIP4-YFP transfected HEK-293 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Donkey anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:KCNIP2Submitted by:Jeanne M. Nerbonne, Arvin Soepriatna, Washington University Medical School Department of Developmental Biology)

product-image-AAA197984_WB10.jpg WB (Western Blot) (Lanes:Lane 1: 20ug HEK-293 cell lysateLane 2: 20ug mkchIP2-YFP transfected HEK-293 lysateLane 3: 20ug mkchIP3-YFP transfected HEK-293 lysateLane 4: 20ug mkchIP4-YFP transfected HEK-293 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Donkey anti-rabbit-HRPSecondary Antibody Dilution:1:10,000Gene Name:KCNIP2Submitted by:Jeanne M. Nerbonne, Arvin Soepriatna, Washington University Medical School Department of Developmental Biology)

WB (Western Blot)

(Host: RabbitTarget Name: KCNIP2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlKCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA197984_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNIP2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlKCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: KCNIP2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA197984_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNIP2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-KCNIP2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA197984_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-KCNIP2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-KCNIP2 antibody
This is a rabbit polyclonal antibody against KCNIP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KCNIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Product Categories/Family for anti-KCNIP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
Kv channel-interacting protein 2
NCBI Official Synonym Full Names
potassium voltage-gated channel interacting protein 2
NCBI Official Symbol
KCNIP2
NCBI Official Synonym Symbols
KCHIP2
NCBI Protein Information
Kv channel-interacting protein 2
UniProt Protein Name
Kv channel-interacting protein 2
UniProt Gene Name
KCNIP2
UniProt Synonym Gene Names
KCHIP2; KChIP2
UniProt Entry Name
KCIP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KCNIP2 kcnip2 (Catalog #AAA197984) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNIP2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KCNIP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KCNIP2 kcnip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALAAPASLRP HRPRLLDPDS VDDEFELSTV CHRPEGLEQL QEQTKFTRKE. It is sometimes possible for the material contained within the vial of "KCNIP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.