Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23441_WB7.jpg WB (Western Blot) (WB Suggested Anti-KCNK9 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit KCNK9 Polyclonal Antibody | anti-KCNK9 antibody

KCNK9 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KCNK9; KT3.2; TASK3; K2p9.1; TASK-3
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
KCNK9, Antibody; KCNK9 antibody - N-terminal region; anti-KCNK9 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Dog
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY
Sequence Length
374
Applicable Applications for anti-KCNK9 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNK9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KCNK9 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA23441_WB7.jpg WB (Western Blot) (WB Suggested Anti-KCNK9 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: KCNK9Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23441_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNK9Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNK9Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23441_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNK9Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNK9Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA23441_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNK9Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

product-image-AAA23441_IHC3.jpg IHC (Immunohistochemistry)

IHC (Immunohistochemistry)

(Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-KCNK9 antibody)

product-image-AAA23441_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-KCNK9 antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-KCNK9 antibody)

product-image-AAA23441_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-KCNK9 antibody)
Related Product Information for anti-KCNK9 antibody
This is a rabbit polyclonal antibody against KCNK9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KCNK9 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This open channel is highly expressed in the cerebellum. It is inhibited by extracellular acidification and arachidonic acid, and strongly inhibited by phorbol 12-myristate 13-acetate.This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This open channel is highly expressed in the cerebellum. It is inhibited by extracellular acidification and arachidonic acid, and strongly inhibited by phorbol 12-myristate 13-acetate. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 9
NCBI Official Symbol
KCNK9
NCBI Official Synonym Symbols
KT3.2; TASK3; K2p9.1; TASK-3
NCBI Protein Information
potassium channel subfamily K member 9
UniProt Protein Name
Potassium channel subfamily K member 9
UniProt Gene Name
KCNK9
UniProt Synonym Gene Names
TASK3; Two pore K(+) channel KT3.2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KCNK9 kcnk9 (Catalog #AAA23441) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNK9 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's KCNK9 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the KCNK9 kcnk9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: REEEKLKAEE IRIKGKYNIS SEDYRQLELV ILQSEPHRAG VQWKFAGSFY. It is sometimes possible for the material contained within the vial of "KCNK9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.