Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197916_WB8.jpg WB (Western Blot) (WB Suggested Anti-KCNN2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit KCNN2 Polyclonal Antibody | anti-KCNN2 antibody

KCNN2 antibody - C-terminal region

Gene Names
KCNN2; SK2; hSK2; SKCA2; KCa2.2; SKCa 2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish, Monkey
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
KCNN2, Antibody; KCNN2 antibody - C-terminal region; anti-KCNN2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish, Monkey
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
Sequence Length
579
Applicable Applications for anti-KCNN2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KCNN2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

product-image-AAA197916_WB8.jpg WB (Western Blot) (WB Suggested Anti-KCNN2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: KCNN2Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

product-image-AAA197916_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNN2Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

WB (Western Blot)

(Host: RabbitTarget Name: KCNN2Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA197916_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNN2Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: KCNN2Gene Name :KCNN2Submitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School)

product-image-AAA197916_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: KCNN2Gene Name :KCNN2Submitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School)

IHC (Immunohistochemistry)

(Lanes:Rat brain sectionPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-biotin, streptavidin-diaminobenzidineSecondary Antibody Dilution:1:500Gene Name:KCNN2Submitted by:Dr. Amiel Rosenkranz, Rosalind Franklin University)

product-image-AAA197916_IHC15.jpg IHC (Immunohistochemistry) (Lanes:Rat brain sectionPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-biotin, streptavidin-diaminobenzidineSecondary Antibody Dilution:1:500Gene Name:KCNN2Submitted by:Dr. Amiel Rosenkranz, Rosalind Franklin University)
Related Product Information for anti-KCNN2 antibody
This is a rabbit polyclonal antibody against KCNN2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.
Product Categories/Family for anti-KCNN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
small conductance calcium-activated potassium channel protein 2 isoform a
NCBI Official Synonym Full Names
potassium calcium-activated channel subfamily N member 2
NCBI Official Symbol
KCNN2
NCBI Official Synonym Symbols
SK2; hSK2; SKCA2; KCa2.2; SKCa 2
NCBI Protein Information
small conductance calcium-activated potassium channel protein 2
UniProt Protein Name
Small conductance calcium-activated potassium channel protein 2
UniProt Gene Name
KCNN2
UniProt Synonym Gene Names
SK2; SKCa 2; SKCa2
UniProt Entry Name
KCNN2_HUMAN

Similar Products

Product Notes

The KCNN2 kcnn2 (Catalog #AAA197916) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNN2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's KCNN2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KCNN2 kcnn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDHAKVRKHQ RKFLQAIHQL RSVKMEQRKL NDQANTLVDL AKTQNIMYDM. It is sometimes possible for the material contained within the vial of "KCNN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.