WB (Western Blot)
(WB Suggested Anti-Kcnq3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Rabbit Kcnq3 Polyclonal Antibody | anti-KCNQ3 antibody
Kcnq3 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Kcnq3, Antibody; Kcnq3 antibody - middle region; anti-KCNQ3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ
Sequence Length
873
Applicable Applications for anti-KCNQ3 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Kcnq3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
WB (Western Blot)
(WB Suggested Anti-Kcnq3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
WB (Western Blot)
(Lanes:100 ug CHO cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:25000Gene Name:Kcnq3Submitted by:Anonymous)
WB (Western Blot)
(Lanes:100 ug CHO cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:25000Gene Name:Kcnq3Submitted by:Anonymous)
Related Product Information for anti-KCNQ3 antibody
This is a rabbit polyclonal antibody against Kcnq3. It was validated on Western Blot
Target Description: Kcnq3 is probably important in the regulation of neuronal excitability. It associates with KCNQ2 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.
Target Description: Kcnq3 is probably important in the regulation of neuronal excitability. It associates with KCNQ2 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.
Product Categories/Family for anti-KCNQ3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily KQT member 3
NCBI Official Synonym Full Names
potassium voltage-gated channel, subfamily Q, member 3
NCBI Official Symbol
Kcnq3
NCBI Protein Information
potassium voltage-gated channel subfamily KQT member 3
UniProt Protein Name
Potassium voltage-gated channel subfamily KQT member 3
UniProt Gene Name
Kcnq3
UniProt Entry Name
KCNQ3_MOUSE
Similar Products
Product Notes
The KCNQ3 kcnq3 (Catalog #AAA197925) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Kcnq3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Kcnq3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KCNQ3 kcnq3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPKHKKSQKG SAFTYPSQQS PRNEPYVARA ATSETEDQSM MGKFVKVERQ. It is sometimes possible for the material contained within the vial of "Kcnq3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.