Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198128_WB13.jpg WB (Western Blot) (WB Suggested Anti-KCTD11 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit anti-Human, Mouse KCTD11 Polyclonal Antibody | anti-KCTD11 antibody

KCTD11 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KCTD11; REN; KCASH1; C17orf36; REN/KCTD11
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Protein A purified
Synonyms
KCTD11, Antibody; KCTD11 antibody - N-terminal region; anti-KCTD11 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH
Sequence Length
232
Applicable Applications for anti-KCTD11 antibody
WB (Western Blot)
Homology
Human: 100%; Mouse: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KCTD11 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

product-image-AAA198128_WB13.jpg WB (Western Blot) (WB Suggested Anti-KCTD11 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: KCTD11Sample Type: 721_BAntibody Dilution: 1.0ug/ml)

product-image-AAA198128_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: KCTD11Sample Type: 721_BAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KCTD11 antibody
This is a rabbit polyclonal antibody against KCTD11. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation of the tumor-promoting Hedgehog pathway in medulloblastoma.
Product Categories/Family for anti-KCTD11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
BTB/POZ domain-containing protein KCTD11 s
NCBI Official Synonym Full Names
potassium channel tetramerization domain containing 11
NCBI Official Symbol
KCTD11
NCBI Official Synonym Symbols
REN; KCASH1; C17orf36; REN/KCTD11
NCBI Protein Information
BTB/POZ domain-containing protein KCTD11
UniProt Protein Name
BTB/POZ domain-containing protein KCTD11
UniProt Gene Name
KCTD11
UniProt Synonym Gene Names
C17orf36; REN
UniProt Entry Name
KCD11_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KCTD11 kctd11 (Catalog #AAA198128) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCTD11 antibody - N-terminal region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KCTD11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KCTD11 kctd11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADFYQIRPLL DALRELEASQ GTPAPTAALL HADVDVSPRL VHFSARRGPH. It is sometimes possible for the material contained within the vial of "KCTD11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.