Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201707_WB8.jpg WB (Western Blot) (KIF20A antibody - middle region validated by WB using 721_B Cell Lysate at 1ug/ml.KIF20A is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit KIF20A Polyclonal Antibody | anti-KIF20A antibody

KIF20A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
KIF20A; MKLP2; RAB6KIFL
Reactivity
Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KIF20A, Antibody; KIF20A antibody - middle region; anti-KIF20A antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRR
Sequence Length
890
Applicable Applications for anti-KIF20A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KIF20A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(KIF20A antibody - middle region validated by WB using 721_B Cell Lysate at 1ug/ml.KIF20A is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA201707_WB8.jpg WB (Western Blot) (KIF20A antibody - middle region validated by WB using 721_B Cell Lysate at 1ug/ml.KIF20A is supported by BioGPS gene expression data to be expressed in 721_B)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0ug/ml using anti-KIF20A antibody)

product-image-AAA201707_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0ug/ml using anti-KIF20A antibody)

IHC (Immunohistochemisry)

(Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue)

product-image-AAA201707_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue)

IHC (Immunohiostchemistry)

(Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue)

product-image-AAA201707_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue)

IHC (Immunohistochemistry)

(Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue)

product-image-AAA201707_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue)
Related Product Information for anti-KIF20A antibody
This is a rabbit polyclonal antibody against KIF20A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KIF20A interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B.It may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus end-directed motility.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100kDa
NCBI Official Full Name
kinesin-like protein KIF20A
NCBI Official Synonym Full Names
kinesin family member 20A
NCBI Official Symbol
KIF20A
NCBI Official Synonym Symbols
MKLP2; RAB6KIFL
NCBI Protein Information
kinesin-like protein KIF20A
UniProt Protein Name
Kinesin-like protein KIF20A
UniProt Gene Name
KIF20A
UniProt Synonym Gene Names
MKLP2; RAB6KIFL; MKlp2
UniProt Entry Name
KI20A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KIF20A kif20a (Catalog #AAA201707) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF20A antibody - middle region reacts with Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIF20A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KIF20A kif20a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRLGTNQENQ QPNQQPPGKK PFLRNLLPRT PTCQSSTDCS PYARILRSRR. It is sometimes possible for the material contained within the vial of "KIF20A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.