Rabbit KIF24 Polyclonal Antibody | anti-KIF24 antibody
KIF24 Antibody - N-terminal region
Gene Names
KIF24; C9orf48; bA571F15.4
Reactivity
Tested: HumanPredicted: Cow, Dog, Guinea Pig, Horse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KIF24, Antibody; KIF24 Antibody - N-terminal region; anti-KIF24 antibody
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Rabbit, Rat
Predicted: Cow, Dog, Guinea Pig, Horse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: IRQNTSEKQNPWTEMEKIRVCVRKRPLGMREVRRGEINIITVEDKETLLV
Sequence Length
1368
Applicable Applications for anti-KIF24 antibody
WB (Western Blot)
Protein Size (#AA)
1368 amino acids
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rabbit: 77%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIF24
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-KIF24 antibody
This is a rabbit polyclonal antibody against KIF24. It was validated on Western Blot
Target Description: Kinesins, such as KIF24, are microtubule-dependent ATPases that function as molecular motors. They play important roles in intracellular vesicle transport and cell division.
Target Description: Kinesins, such as KIF24, are microtubule-dependent ATPases that function as molecular motors. They play important roles in intracellular vesicle transport and cell division.
Product Categories/Family for anti-KIF24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140kDa
NCBI Official Full Name
kinesin-like protein KIF24
NCBI Official Synonym Full Names
kinesin family member 24
NCBI Official Symbol
KIF24
NCBI Official Synonym Symbols
C9orf48; bA571F15.4
NCBI Protein Information
kinesin-like protein KIF24
UniProt Protein Name
Kinesin-like protein KIF24
UniProt Gene Name
KIF24
UniProt Synonym Gene Names
C9orf48
UniProt Entry Name
KIF24_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The KIF24 kif24 (Catalog #AAA201391) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF24 Antibody - N-terminal region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Horse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIF24 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KIF24 kif24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IRQNTSEKQN PWTEMEKIRV CVRKRPLGMR EVRRGEINII TVEDKETLLV. It is sometimes possible for the material contained within the vial of "KIF24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
