Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197693_WB13.jpg WB (Western Blot) (WB Suggested Anti-KIF25 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Rabbit KIF25 Polyclonal Antibody | anti-KIF25 antibody

KIF25 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
KIF25; KNSL3
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
KIF25, Antibody; KIF25 antibody - C-terminal region; anti-KIF25 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL
Sequence Length
384
Applicable Applications for anti-KIF25 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KIF25
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KIF25 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA197693_WB13.jpg WB (Western Blot) (WB Suggested Anti-KIF25 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA197693_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-KIF25 antibody
This is a rabbit polyclonal antibody against KIF25. It was validated on Western Blot and immunohistochemistry

Target Description: The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.
Product Categories/Family for anti-KIF25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
kinesin-like protein KIF25 isoform 1
NCBI Official Synonym Full Names
kinesin family member 25
NCBI Official Symbol
KIF25
NCBI Official Synonym Symbols
KNSL3
NCBI Protein Information
kinesin-like protein KIF25
UniProt Protein Name
Kinesin-like protein KIF25
UniProt Gene Name
KIF25
UniProt Synonym Gene Names
KNSL3
UniProt Entry Name
KIF25_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KIF25 kif25 (Catalog #AAA197693) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF25 antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIF25 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KIF25 kif25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLGALLEHRG HAPYRNSRLT HLLQDCLGGD AKLLVILCIS PSQRHLAQTL. It is sometimes possible for the material contained within the vial of "KIF25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.