Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197690_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: Kif3bSample Type: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)

Rabbit KIF3B Polyclonal Antibody | anti-KIF3B antibody

KIF3B Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
KIF3B; FLA8; HH0048; KLP-11
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KIF3B, Antibody; KIF3B Antibody - middle region; anti-KIF3B antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGGEEEEEEGEEGEEDGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKM
Sequence Length
747
Applicable Applications for anti-KIF3B antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse KIF3B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: Kif3bSample Type: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA197690_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: Kif3bSample Type: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KIF3BSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA197690_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: KIF3BSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
Related Product Information for anti-KIF3B antibody
This is a rabbit polyclonal antibody against Kif3b . It was validated on Western Blot

Target Description: The protein encoded by this gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.
Product Categories/Family for anti-KIF3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
kinesin-like protein KIF3B
NCBI Official Synonym Full Names
kinesin family member 3B
NCBI Official Symbol
KIF3B
NCBI Official Synonym Symbols
FLA8; HH0048; KLP-11
NCBI Protein Information
kinesin-like protein KIF3B
UniProt Protein Name
Kinesin-like protein KIF3B
UniProt Gene Name
KIF3B
UniProt Synonym Gene Names
KIAA0359
UniProt Entry Name
KIF3B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KIF3B kif3b (Catalog #AAA197690) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF3B Antibody - middle region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KIF3B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KIF3B kif3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGGEEEEEEG EEGEEDGDDK DDYWREQQEK LEIEKRAIVE DHSLVAEEKM. It is sometimes possible for the material contained within the vial of "KIF3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.