Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197680_WB11.jpg WB (Western Blot) (WB Suggested Anti-KIF5A Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit KIF5A Polyclonal Antibody | anti-KIF5A antibody

KIF5A antibody - middle region

Gene Names
KIF5A; NKHC; ALS25; MY050; NEIMY; SPG10; D12S1889
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KIF5A, Antibody; KIF5A antibody - middle region; anti-KIF5A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH
Sequence Length
1032
Applicable Applications for anti-KIF5A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 79%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KIF5A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KIF5A Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

product-image-AAA197680_WB11.jpg WB (Western Blot) (WB Suggested Anti-KIF5A Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

IHC (Immunohiostchemistry)

(Rabbit Anti-KIF5A antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197680_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-KIF5A antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-KIF5A antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197680_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-KIF5A antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-KIF5A antibody
This is a rabbit polyclonal antibody against KIF5A. It was validated on Western Blot and immunohistochemistry

Target Description: KIF5A is a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.
Product Categories/Family for anti-KIF5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
117kDa
NCBI Official Full Name
kinesin heavy chain isoform 5A isoform 1
NCBI Official Synonym Full Names
kinesin family member 5A
NCBI Official Symbol
KIF5A
NCBI Official Synonym Symbols
NKHC; ALS25; MY050; NEIMY; SPG10; D12S1889
NCBI Protein Information
kinesin heavy chain isoform 5A
UniProt Protein Name
Kinesin heavy chain isoform 5A
UniProt Gene Name
KIF5A
UniProt Synonym Gene Names
NKHC1; NKHC
UniProt Entry Name
KIF5A_HUMAN

Similar Products

Product Notes

The KIF5A kif5a (Catalog #AAA197680) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF5A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIF5A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KIF5A kif5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEESYDSLSD ELAKLQAQET VHEVALKDKE PDTQDADEVK KALELQMESH. It is sometimes possible for the material contained within the vial of "KIF5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.