Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46443_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Kininogen 1 Picoband antibody, AAA46443, IHC(P)IHC(P): Mouse Kidney Tissue)

anti-Mouse Kininogen 1 Polyclonal Antibody | anti-Kng1 antibody

Anti-Kininogen 1 Antibody

Gene Names
Kng1; Kng
Reactivity
Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Kininogen 1, Antibody; Anti-Kininogen 1 Antibody; Kininogen-1; Alpha-2-thiol proteinase inhibitor; BDK; BK; Bradykinin; Fitzgerald factor; High molecular weight kininogen; HMWK; Ile-Ser-Bradykinin; Kallidin I; Kallidin II; Kininogen; KNG; KNG1; KNG1_HUMAN; Low molecular weight growth-promoting factor; Williams-Fitzgerald-Flaujeac factor; kininogen 1; anti-Kng1 antibody
Ordering
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
661
Applicable Applications for anti-Kng1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- Kininogen 1 Picoband antibody, AAA46443, IHC(P)IHC(P): Mouse Kidney Tissue)

product-image-AAA46443_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Kininogen 1 Picoband antibody, AAA46443, IHC(P)IHC(P): Mouse Kidney Tissue)

WB (Western Blot)

(Anti- Kininogen 1 Picoband antibody, AAA46443, Western blottingAll lanes: Anti Kininogen 1 (AAA46443) at 0.5ug/mlLane 1: Mouse Lung Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: HEPA Whole Cell Lysate at 40ugLane 5: NEURO Whole Cell Lysate at 40ugPredicted bind size: 73KDObserved bind size: 73KD)

product-image-AAA46443_WB15.jpg WB (Western Blot) (Anti- Kininogen 1 Picoband antibody, AAA46443, Western blottingAll lanes: Anti Kininogen 1 (AAA46443) at 0.5ug/mlLane 1: Mouse Lung Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: HEPA Whole Cell Lysate at 40ugLane 5: NEURO Whole Cell Lysate at 40ugPredicted bind size: 73KDObserved bind size: 73KD)
Related Product Information for anti-Kng1 antibody
Description: Rabbit IgG polyclonal antibody for Kininogen-1(KNG1) detection. Tested with WB, IHC-P in Mouse.

Background: Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene. It is mapped to 3q27.3. The KNG1 gene uses alternative splicing to generate two different proteins high molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system.
References
1. "Entrez Gene: kininogen 1". 2. Fong, D., Smith, D. I., Hsieh, W.-T. The human kininogen gene (KNG) mapped to chromosome 3q26-qter by analysis of somatic cell hybrids using the polymerase chain reaction. Hum. Genet. 87: 189-192, 1991.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,206 Da
NCBI Official Full Name
kininogen-1 isoform 1
NCBI Official Synonym Full Names
kininogen 1
NCBI Official Symbol
Kng1
NCBI Official Synonym Symbols
Kng
NCBI Protein Information
kininogen-1
UniProt Protein Name
Kininogen-1
UniProt Gene Name
Kng1
UniProt Synonym Gene Names
Kng
UniProt Entry Name
KNG1_MOUSE

Similar Products

Product Notes

The Kng1 kng1 (Catalog #AAA46443) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Kininogen 1 Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Kininogen 1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Kng1 kng1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Kininogen 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.