Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200286_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: KLBSample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Rabbit KLB Polyclonal Antibody | anti-KLB antibody

KLB antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
KLB; BKL
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KLB, Antibody; KLB antibody - middle region; anti-KLB antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
Sequence Length
1044
Applicable Applications for anti-KLB antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KLB
Protein Size (# AA)
1044 amino acids
Protein Interactions
FGF21;
Enhanced Validation
WB
Y
SPR
Y
CHAROS
Blocking Peptide
For anti-KLB (MBS3211254) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: KLBSample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200286_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: KLBSample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KLOTBSample Type: 721_B Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

product-image-AAA200286_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: KLOTBSample Type: 721_B Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KLBSample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml.)

product-image-AAA200286_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: KLBSample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of formalin-fixed, paraffin-embedded human colon tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

product-image-AAA200286_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of formalin-fixed, paraffin-embedded human colon tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

IHC (Immunohistochemistry)

(Human Testis; Immunohistochemistry of formalin-fixed, paraffin-embedded human testis tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)

product-image-AAA200286_IHC15.jpg IHC (Immunohistochemistry) (Human Testis; Immunohistochemistry of formalin-fixed, paraffin-embedded human testis tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.)
Related Product Information for anti-KLB antibody
This is a rabbit polyclonal antibody against KLB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120kDa
NCBI Official Full Name
beta-klotho
NCBI Official Synonym Full Names
klotho beta
NCBI Official Symbol
KLB
NCBI Official Synonym Symbols
BKL
NCBI Protein Information
beta-klotho
UniProt Protein Name
Beta-klotho
UniProt Gene Name
KLB
UniProt Synonym Gene Names
BKL; BetaKlotho

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KLB klb (Catalog #AAA200286) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLB antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's KLB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KLB klb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DAYTIRRGLF YVDFNSKQKE RKPKSSAHYY KQIIRENGFS LKESTPDVQG. It is sometimes possible for the material contained within the vial of "KLB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.