Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA162530_IHC13.jpg IHC (Immunohiostchemistry) (KLF2 Antibody-Anti-KLF2 antibody IHC of mouse lymphoid tissue. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

Rabbit anti-Mouse KLF2 Polyclonal Antibody | anti-KLF2 antibody

KLF2 Rabbit anti-Mouse Polyclonal (N-Terminus) Antibody

Average rating 0.0
No ratings yet
Reactivity
Mouse
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Immunoaffinity purified
Synonyms
KLF2, Antibody; KLF2 Rabbit anti-Mouse Polyclonal (N-Terminus) Antibody; KLF2 Antibody (N-Terminus); KLF2; Krueppel-like factor 2; Kruppel-like factor LKLF; Kruppel-like factor 2 (lung); Lung krueppel-like factor; LKLF; anti-KLF2 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Specificity
Mouse KLF2
Purity/Purification
Immunoaffinity purified
Form/Format
PBS, 0.09% sodium azide, 2% sucrose
Concentration
0.5mg/ml (varies by lot)
Applicable Applications for anti-KLF2 antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Target
Mouse KLF2
Immunogen
Synthetic peptide from N-Terminus of mouse Klf2 (Q60843, NP_032478) within the region MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM. Percent identity by BLAST analysis: Mouse, Zebra finch, Chicken (100%); Marmoset, Rat, Opossum (92%); Human, Gibbon, Galago, Pig (85%); Xenopus (83%).
Conjugation
Unconjugated
Epitope
N-Terminus
Preparation and Storage
Short term: Store at 2-8 degree C. Long term: Aliquot and store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(KLF2 Antibody-Anti-KLF2 antibody IHC of mouse lymphoid tissue. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

product-image-AAA162530_IHC13.jpg IHC (Immunohiostchemistry) (KLF2 Antibody-Anti-KLF2 antibody IHC of mouse lymphoid tissue. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

WB (Western Blot)

(KLF2 Antibody-KLF2 antibody Western blot of Mouse Small Intestine lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

product-image-AAA162530_WB15.jpg WB (Western Blot) (KLF2 Antibody-KLF2 antibody Western blot of Mouse Small Intestine lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.)
Related Product Information for anti-KLF2 antibody
KLF2 antibody is an unconjugated rabbit polyclonal antibody to mouse KLF2 (N-Terminus). Validated for IHC and WB. Cited in 2 publications.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
UniProt Protein Name
Krueppel-like factor 2
UniProt Gene Name
KLF2
UniProt Synonym Gene Names
LKLF

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KLF2 klf2 (Catalog #AAA162530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLF2 Rabbit anti-Mouse Polyclonal (N-Terminus) Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KLF2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KLF2 klf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.