Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198474_WB13.jpg WB (Western Blot) (WB Suggested Anti-KLHL26 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateKLHL26 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit KLHL26 Polyclonal Antibody | anti-KLHL26 antibody

KLHL26 antibody - C-terminal region

Average rating 0.0
No ratings yet
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
KLHL26, Antibody; KLHL26 antibody - C-terminal region; anti-KLHL26 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAG
Sequence Length
615
Applicable Applications for anti-KLHL26 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KLHL26
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KLHL26 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateKLHL26 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA198474_WB13.jpg WB (Western Blot) (WB Suggested Anti-KLHL26 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateKLHL26 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Rabbit Anti-KLHL26 antibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198474_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-KLHL26 antibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-KLHL26 antibody
This is a rabbit polyclonal antibody against KLHL26. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of KLHL26 remains unknown.
Product Categories/Family for anti-KLHL26 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
kelch-like protein 26 isoform 2
NCBI Official Synonym Full Names
kelch like family member 26
NCBI Official Symbol
KLHL26
NCBI Protein Information
kelch-like protein 26
UniProt Protein Name
Kelch-like protein 26
UniProt Gene Name
KLHL26
UniProt Entry Name
KLH26_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KLHL26 klhl26 (Catalog #AAA198474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHL26 antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KLHL26 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KLHL26 klhl26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAGCCLLERK IYIVGGYNWR LNNVTGIVQV YNTDTDEWER DLHFPESFAG. It is sometimes possible for the material contained within the vial of "KLHL26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.