Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197835_WB13.jpg WB (Western Blot) (WB Suggested Anti-KLHL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: THP-1 cell lysate)

Rabbit KLHL3 Polyclonal Antibody | anti-KLHL3 antibody

KLHL3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KLHL3; PHA2D
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KLHL3, Antibody; KLHL3 antibody - N-terminal region; anti-KLHL3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENV
Sequence Length
587
Applicable Applications for anti-KLHL3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KLHL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: THP-1 cell lysate)

product-image-AAA197835_WB13.jpg WB (Western Blot) (WB Suggested Anti-KLHL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: THP-1 cell lysate)

IHC (Immunohistochemistry)

(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :KLHL3: Red DAPI:BlueGene Name :KLHL3Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA197835_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :KLHL3: Red DAPI:BlueGene Name :KLHL3Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-KLHL3 antibody
This is a rabbit polyclonal antibody against KLHL3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KLHL3 protein contains a poxvirus and zinc finger domain at the N-terminus and six tandem repeats (kelch repeats) at the C-terminus. At the amino acid level, KLHL3 shares 77% similarity with Drosophila kelch and 89% similarity with Mayven (KLHL2), another human kelch homolog. At least three isoforms are produced and may be the result of alternative promoter usage. The KLHL3 maps within the smallest commonly deleted segment in myeloid leukemias characterized by a deletion of 5q; however, no inactivating mutations of KLHL3 could be detected in malignant myeloid disorders with loss of 5q.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
kelch-like protein 3 isoform 1
NCBI Official Synonym Full Names
kelch like family member 3
NCBI Official Symbol
KLHL3
NCBI Official Synonym Symbols
PHA2D
NCBI Protein Information
kelch-like protein 3
UniProt Protein Name
Kelch-like protein 3
UniProt Gene Name
KLHL3
UniProt Synonym Gene Names
KIAA1129
UniProt Entry Name
KLHL3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KLHL3 klhl3 (Catalog #AAA197835) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHL3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KLHL3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KLHL3 klhl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSPYFCAMFT GDMSESKAKK IEIKDVDGQT LSKLIDYIYT AEIEVTEENV. It is sometimes possible for the material contained within the vial of "KLHL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.