Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197686_WB11.jpg WB (Western Blot) (WB Suggested Anti-KLK6 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Rabbit KLK6 Polyclonal Antibody | anti-KLK6 antibody

KLK6 antibody - N-terminal region

Gene Names
KLK6; hK6; Bssp; Klk7; SP59; PRSS9; PRSS18
Reactivity
Dog, Horse, Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KLK6, Antibody; KLK6 antibody - N-terminal region; anti-KLK6 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
Sequence Length
244
Applicable Applications for anti-KLK6 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 92%; Horse: 92%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KLK6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KLK6 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

product-image-AAA197686_WB11.jpg WB (Western Blot) (WB Suggested Anti-KLK6 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: KLK6Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA197686_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: KLK6Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Lung)

product-image-AAA197686_IHC15.jpg IHC (Immunohistochemistry) (Lung)
Related Product Information for anti-KLK6 antibody
This is a rabbit polyclonal antibody against KLK6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene that encodes KLK6 protein is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. KLK6 is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease.Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. The encoded enzyme is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease. Multiple alternatively spliced transcript variants that encode different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
kallikrein-6 isoform A preproprotein
NCBI Official Synonym Full Names
kallikrein related peptidase 6
NCBI Official Symbol
KLK6
NCBI Official Synonym Symbols
hK6; Bssp; Klk7; SP59; PRSS9; PRSS18
NCBI Protein Information
kallikrein-6
UniProt Protein Name
Kallikrein-6
UniProt Gene Name
KLK6
UniProt Synonym Gene Names
PRSS18; PRSS9
UniProt Entry Name
KLK6_HUMAN

Similar Products

Product Notes

The KLK6 klk6 (Catalog #AAA197686) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLK6 antibody - N-terminal region reacts with Dog, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLK6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KLK6 klk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KHNLRQRESS QEQSSVVRAV IHPDYDAASH DQDIMLLRLA RPAKLSELIQ. It is sometimes possible for the material contained within the vial of "KLK6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.