Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200139_WB11.jpg WB (Western Blot) (WB Suggested Anti-Suv420h1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

Rabbit KMT5B Polyclonal Antibody | anti-KMT5B antibody

KMT5B Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
Kmt5b; AA117471; Suv420h1; Suv4-20h1; C630029K18Rik
Reactivity
Tested: Mouse
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity Purified
Synonyms
KMT5B, Antibody; KMT5B Antibody - C-terminal region; anti-KMT5B antibody
Ordering
Host
Rabbit
Reactivity
Tested: Mouse
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 0.5-1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC
Sequence Length
327
Applicable Applications for anti-KMT5B antibody
WB (Western Blot), ChIP (Chromatin immunoprecipitation)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 77%
Protein Size
327 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Suv420h1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

product-image-AAA200139_WB11.jpg WB (Western Blot) (WB Suggested Anti-Suv420h1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

ChIP (Chromatin Immunoprecipitation)

(Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

product-image-AAA200139_CHIP13.jpg ChIP (Chromatin Immunoprecipitation) (Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

ChIP (Chromatin Immunoprecipitation)

(Chromatin Immunoprecipitation (ChIP) Using Suv420h1 antibody - C-terminal region and HCT116 Cells)

product-image-AAA200139_CHIP15.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin Immunoprecipitation (ChIP) Using Suv420h1 antibody - C-terminal region and HCT116 Cells)
Related Product Information for anti-KMT5B antibody
This is a rabbit polyclonal antibody against Suv420h1. It was validated on Western Blot

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
histone-lysine N-methyltransferase KMT5B isoform d
NCBI Official Synonym Full Names
lysine methyltransferase 5B
NCBI Official Symbol
Kmt5b
NCBI Official Synonym Symbols
AA117471; Suv420h1; Suv4-20h1; C630029K18Rik
NCBI Protein Information
histone-lysine N-methyltransferase KMT5B
UniProt Protein Name
Histone-lysine N-methyltransferase SUV420H1
UniProt Gene Name
Suv420h1
UniProt Synonym Gene Names
Su(var)4-20 homolog 1; Suv4-20h1
UniProt Entry Name
SV421_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KMT5B suv420h1 (Catalog #AAA200139) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KMT5B Antibody - C-terminal region reacts with Tested: Mouse Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KMT5B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ChIP (Chromatin immunoprecipitation). Researchers should empirically determine the suitability of the KMT5B suv420h1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FINHDCRPNC KFVSTGRDTA CVKALRDIEP GEEISCYYGD GFFGENNEFC. It is sometimes possible for the material contained within the vial of "KMT5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.