Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281634_WB11.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and KMT5C Rabbit pAb knockout (KO) 293T cells, using KMT5C Rabbit pAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit anti-Human, Mouse KMT5C Polyclonal Antibody | anti-KMT5C antibody

[KO Validated] KMT5C Rabbit pAb

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
KMT5C, Antibody; [KO Validated] KMT5C Rabbit pAb; KMT5C; SUV420H2; Suv4-20h2; anti-KMT5C antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC
Applicable Applications for anti-KMT5C antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2).
Cellular Location
Chromosome, Nucleus
Positive Samples
HeLa, 293T, Jurkat, Mouse thymus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and KMT5C Rabbit pAb knockout (KO) 293T cells, using KMT5C Rabbit pAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA281634_WB11.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and KMT5C Rabbit pAb knockout (KO) 293T cells, using KMT5C Rabbit pAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

WB (Western Blot)

(Western blot analysis of extracts of Mouse thymus, using KMT5C antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA281634_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Mouse thymus, using KMT5C antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using KMT5C antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA281634_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using KMT5C antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-KMT5C antibody
Background: SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20).

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 10kDa/52kDa
Observed MW: 52KDa
UniProt Protein Name
Histone-lysine N-methyltransferase SUV420H2
UniProt Gene Name
SUV420H2
UniProt Synonym Gene Names
KMT5C
UniProt Entry Name
SV422_HUMAN

Similar Products

Product Notes

The KMT5C suv420h2 (Catalog #AAA281634) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] KMT5C Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KMT5C can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KMT5C suv420h2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FLPESGFTIL PCTRYSMETN GAKIVSTRAW KKNEKLELLV GCIAELREAD EGLLRAGEND FSIMYSTRKR SAQLWLGPAA FINHDCKPNC KFVPADGNAA C. It is sometimes possible for the material contained within the vial of "KMT5C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.