Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200398_WB10.jpg WB (Western Blot) (WB Suggested Anti-KPNA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateKPNA4 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit KPNA4 Polyclonal Antibody | anti-KPNA4 antibody

KPNA4 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KPNA4; QIP1; SRP3; IPOA3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KPNA4, Antibody; KPNA4 antibody - N-terminal region; anti-KPNA4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI
Sequence Length
521
Applicable Applications for anti-KPNA4 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KPNA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KPNA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateKPNA4 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA200398_WB10.jpg WB (Western Blot) (WB Suggested Anti-KPNA4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateKPNA4 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(KPNA4 antibody - N-terminal region validated by WB using Neuro 2A Cells at 1:500.)

product-image-AAA200398_WB11.jpg WB (Western Blot) (KPNA4 antibody - N-terminal region validated by WB using Neuro 2A Cells at 1:500.)

WB (Western Blot)

(Host: RabbitTarget Name: KPNA4Sample Type: MCF7Antibody Dilution: 1.0ug/mlKPNA4 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA200398_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: KPNA4Sample Type: MCF7Antibody Dilution: 1.0ug/mlKPNA4 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: KPNA4Sample Type: HelaAntibody Dilution: 1.0ug/mlKPNA4 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA200398_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: KPNA4Sample Type: HelaAntibody Dilution: 1.0ug/mlKPNA4 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-KPNA4 antibody
This is a rabbit polyclonal antibody against KPNA4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore complex. KPNA4 shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen.The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore complex. The protein encoded by this gene shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-KPNA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
importin subunit alpha-3
NCBI Official Synonym Full Names
karyopherin subunit alpha 4
NCBI Official Symbol
KPNA4
NCBI Official Synonym Symbols
QIP1; SRP3; IPOA3
NCBI Protein Information
importin subunit alpha-3
UniProt Protein Name
Importin subunit alpha-3
UniProt Gene Name
KPNA4
UniProt Synonym Gene Names
QIP1; Qip1
UniProt Entry Name
IMA3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KPNA4 kpna4 (Catalog #AAA200398) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KPNA4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KPNA4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KPNA4 kpna4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNKRDEHLLK RRNVPHEDIC EDSDIDGDYR VQNTSLEAIV QNASSDNQGI. It is sometimes possible for the material contained within the vial of "KPNA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.