Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201070_WB13.jpg WB (Western Blot) (WB Suggested Anti-KPNB1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellThere is BioGPS gene expression data showing that KPNB1 is expressed in ACHN)

Rabbit KPNB1 Polyclonal Antibody | anti-KPNB1 antibody

KPNB1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KPNB1; IMB1; IPO1; IPOB; Impnb; NTF97
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KPNB1, Antibody; KPNB1 antibody - N-terminal region; anti-KPNB1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLA
Sequence Length
876
Applicable Applications for anti-KPNB1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KPNB1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellThere is BioGPS gene expression data showing that KPNB1 is expressed in ACHN)

product-image-AAA201070_WB13.jpg WB (Western Blot) (WB Suggested Anti-KPNB1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellThere is BioGPS gene expression data showing that KPNB1 is expressed in ACHN)

WB (Western Blot)

(WB Suggested Anti-KPNB1 AntibodyPositive Control: Lane 1: 80ug mouse brain extractLane 2: 80ug rat brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution : 1:20,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA201070_WB15.jpg WB (Western Blot) (WB Suggested Anti-KPNB1 AntibodyPositive Control: Lane 1: 80ug mouse brain extractLane 2: 80ug rat brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution : 1:20,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-KPNB1 antibody
This is a rabbit polyclonal antibody against KPNB1. It was validated on Western Blot

Target Description: Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family.
Product Categories/Family for anti-KPNB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
importin subunit beta-1 isoform 1
NCBI Official Synonym Full Names
karyopherin subunit beta 1
NCBI Official Symbol
KPNB1
NCBI Official Synonym Symbols
IMB1; IPO1; IPOB; Impnb; NTF97
NCBI Protein Information
importin subunit beta-1
UniProt Protein Name
Importin subunit beta-1
UniProt Gene Name
KPNB1
UniProt Synonym Gene Names
NTF97; PTAC97
UniProt Entry Name
IMB1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KPNB1 kpnb1 (Catalog #AAA201070) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KPNB1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KPNB1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KPNB1 kpnb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHMKESTLEA IGYICQDIDP EQLQDKSNEI LTAIIQGMRK EEPSNNVKLA. It is sometimes possible for the material contained within the vial of "KPNB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.