Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200677_WB13.jpg WB (Western Blot) (WB Suggested Anti-KRCC1 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysateKRCC1 is supported by BioGPS gene expression data to be expressed in ACHN)

Rabbit anti-Horse, Human KRCC1 Polyclonal Antibody | anti-KRCC1 antibody

KRCC1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KRCC1; CHBP2
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KRCC1, Antibody; KRCC1 antibody - N-terminal region; anti-KRCC1 antibody
Ordering
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENR
Sequence Length
259
Applicable Applications for anti-KRCC1 antibody
WB (Western Blot)
Homology
Horse: 77%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KRCC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KRCC1 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysateKRCC1 is supported by BioGPS gene expression data to be expressed in ACHN)

product-image-AAA200677_WB13.jpg WB (Western Blot) (WB Suggested Anti-KRCC1 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysateKRCC1 is supported by BioGPS gene expression data to be expressed in ACHN)

WB (Western Blot)

(Host: RabbitTarget Name: KRCC1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlKRCC1 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA200677_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: KRCC1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlKRCC1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-KRCC1 antibody
This is a rabbit polyclonal antibody against KRCC1. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-KRCC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
lysine-rich coiled-coil protein 1
NCBI Official Synonym Full Names
lysine rich coiled-coil 1
NCBI Official Symbol
KRCC1
NCBI Official Synonym Symbols
CHBP2
NCBI Protein Information
lysine-rich coiled-coil protein 1
UniProt Protein Name
Lysine-rich coiled-coil protein 1
UniProt Gene Name
KRCC1
UniProt Synonym Gene Names
CHBP2; BM-003; BM-044
UniProt Entry Name
KRCC1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KRCC1 krcc1 (Catalog #AAA200677) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRCC1 antibody - N-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's KRCC1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KRCC1 krcc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMKGDYLETC GYKGEVNSRP TYRMFDQRLP SETIQTYPRS CNIPQTVENR. It is sometimes possible for the material contained within the vial of "KRCC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.