Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198586_WB8.jpg WB (Western Blot) (WB Suggested Anti-KRT18 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateKRT18 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit KRT18 Polyclonal Antibody | anti-KRT18 antibody

KRT18 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KRT18; K18; CK-18; CYK18
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
KRT18, Antibody; KRT18 antibody - N-terminal region; anti-KRT18 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSF
Sequence Length
430
Applicable Applications for anti-KRT18 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KRT18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KRT18 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateKRT18 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA198586_WB8.jpg WB (Western Blot) (WB Suggested Anti-KRT18 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateKRT18 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(WB Suggested Anti-KRT18 antibody Titration: 1 ug/mLSample Type: Human HepG2)

product-image-AAA198586_WB10.jpg WB (Western Blot) (WB Suggested Anti-KRT18 antibody Titration: 1 ug/mLSample Type: Human HepG2)

WB (Western Blot)

(WB Suggested Anti-KRT18 antibody Titration: 1 ug/mLSample Type: Human Hela)

product-image-AAA198586_WB11.jpg WB (Western Blot) (WB Suggested Anti-KRT18 antibody Titration: 1 ug/mLSample Type: Human Hela)

IHC (Immunohiostchemistry)

(Rabbit Anti-KRT18 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198586_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-KRT18 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-KRT18 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198586_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-KRT18 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-KRT18 antibody
This is a rabbit polyclonal antibody against KRT18. It was validated on Western Blot and immunohistochemistry

Target Description: KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis.KRT18 encodes the type I intermediate filament chain keratin 18. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-KRT18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
keratin, type I cytoskeletal 18
NCBI Official Synonym Full Names
keratin 18
NCBI Official Symbol
KRT18
NCBI Official Synonym Symbols
K18; CK-18; CYK18
NCBI Protein Information
keratin, type I cytoskeletal 18
UniProt Protein Name
Keratin, type I cytoskeletal 18
UniProt Gene Name
KRT18
UniProt Synonym Gene Names
CYK18; CK-18; K18
UniProt Entry Name
K1C18_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KRT18 krt18 (Catalog #AAA198586) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT18 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KRT18 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KRT18 krt18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TRSTFSTNYR SLGSVQAPSY GARPVSSAAS VYAGAGGSGS RISVSRSTSF. It is sometimes possible for the material contained within the vial of "KRT18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.