Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA21322_IHC6.jpg IHC (Immunohistchemistry) (KRT19/CK19/Cytokeratin 19 Antibody-Immunohistochemistry of paraffin-embedded human liver cancer tissue, with a concentration of 1:100.)

Rabbit KRT19/CK19/Cytokeratin 19 Polyclonal Antibody | anti-KRT19 antibody

KRT19/CK19/Cytokeratin 19 Rabbit anti-Human Polyclonal Antibody

Gene Names
KRT19; K19; CK19; K1CS
Reactivity
Mouse, Rat, Human
Applications
Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
KRT19/CK19/Cytokeratin 19, Antibody; KRT19/CK19/Cytokeratin 19 Rabbit anti-Human Polyclonal Antibody; IHC-plus KRT19/CK19/Cytokeratin 19 Antibody; KRT19; CK19; Cytokeratin 19; Cytokeratin-19; Keratin 19; Keratin-19; CK-19; K19; K1CS; Keratin; type I; 40-kd; anti-KRT19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human KRT19/CK19/Cytokeratin 19
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-KRT19 antibody
Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB)
Application Notes
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 44kDa, while the observed MW by Western blot was 46kDa.
Target
Human KRT19/CK19/Cytokeratin 19
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 241-400 of human KRT19 (NP_002267.2). PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistchemistry)

(KRT19/CK19/Cytokeratin 19 Antibody-Immunohistochemistry of paraffin-embedded human liver cancer tissue, with a concentration of 1:100.)

product-image-AAA21322_IHC6.jpg IHC (Immunohistchemistry) (KRT19/CK19/Cytokeratin 19 Antibody-Immunohistochemistry of paraffin-embedded human liver cancer tissue, with a concentration of 1:100.)

IHC (Immunohistochemistry)

(KRT19/CK19/Cytokeratin 19 Antibody-Immunohistochemistry of paraffin-embedded rat kidney tissue, with a concentration of 1:100.)

product-image-AAA21322_IHC5.jpg IHC (Immunohistochemistry) (KRT19/CK19/Cytokeratin 19 Antibody-Immunohistochemistry of paraffin-embedded rat kidney tissue, with a concentration of 1:100.)

IHC (Immunohistochemistry)

(KRT19/CK19/Cytokeratin 19 Antibody-Immunohistochemistry of paraffin-embedded mouse heart, with a concentration of 1:100.)

product-image-AAA21322_IHC4.jpg IHC (Immunohistochemistry) (KRT19/CK19/Cytokeratin 19 Antibody-Immunohistochemistry of paraffin-embedded mouse heart, with a concentration of 1:100.)

IHC (Immunohistochemistry)

(KRT19/CK19/Cytokeratin 19 Antibody-Immunohistochemistry of paraffin-embedded mouse kidney tissue, with a concentration of 1:100.)

product-image-AAA21322_IHC3.jpg IHC (Immunohistochemistry) (KRT19/CK19/Cytokeratin 19 Antibody-Immunohistochemistry of paraffin-embedded mouse kidney tissue, with a concentration of 1:100.)

IHC (Immunohistochemistry)

(KRT19/CK19/Cytokeratin 19 Antibody-Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.)

product-image-AAA21322_IHC2.jpg IHC (Immunohistochemistry) (KRT19/CK19/Cytokeratin 19 Antibody-Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.)

WB (Western Blot)

(KRT19/CK19/Cytokeratin 19 Antibody-Western blot analysis of extracts of mouse stomach, using KRT19 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 120s.)

product-image-AAA21322_WB.jpg WB (Western Blot) (KRT19/CK19/Cytokeratin 19 Antibody-Western blot analysis of extracts of mouse stomach, using KRT19 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 120s.)
Related Product Information for anti-KRT19 antibody
Cytokeratin 19 antibody is an unconjugated rabbit polyclonal antibody to Cytokeratin 19 (KRT19/CK19) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,106 Da
NCBI Official Full Name
keratin, type I cytoskeletal 19
NCBI Official Synonym Full Names
keratin 19
NCBI Official Symbol
KRT19
NCBI Official Synonym Symbols
K19; CK19; K1CS
NCBI Protein Information
keratin, type I cytoskeletal 19; CK-19; keratin-19; cytokeratin 19; cytokeratin-19; keratin, type I, 40-kd; 40-kDa keratin intermediate filament
UniProt Protein Name
Keratin, type I cytoskeletal 19
UniProt Gene Name
KRT19
UniProt Synonym Gene Names
CK-19; K19
UniProt Entry Name
K1C19_HUMAN

Similar Products

Product Notes

The KRT19 krt19 (Catalog #AAA21322) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT19/CK19/Cytokeratin 19 Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's KRT19/CK19/Cytokeratin 19 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB). IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 44kDa, while the observed MW by Western blot was 46kDa. Researchers should empirically determine the suitability of the KRT19 krt19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KRT19/CK19/Cytokeratin 19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.