Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283251_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from HeLa cells using Ku80 Rabbit pAb (AAA283251) at 1:900 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit anti-Mouse Ku80 Polyclonal Antibody | anti-Xrcc5 antibody

Ku80 Rabbit pAb

Reactivity
Mouse
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
Ku80, Antibody; Ku80 Rabbit pAb; Ku80; Ku86; CTC85; CTCBF; anti-Xrcc5 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
IKKKNQVTAQDVFQDNHEEGPAAKKYKTEKEEDHISISSLAEGNITKVGSVNPVENFRFLVRQKIASFEEASLQLISHIEQFLDTNETLYFMKSMDCIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSITAEEATKFLAPKDKAKEDTTGPEEAGDVDDLLDMI
Applicable Applications for anti-Xrcc5 antibody
ELISA, WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 543-732 of mouse Ku80 (NP_033559.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide,50% glycerol,pH7.3.

WB (Western Blot)

(Western blot analysis of lysates from HeLa cells using Ku80 Rabbit pAb (AAA283251) at 1:900 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA283251_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from HeLa cells using Ku80 Rabbit pAb (AAA283251) at 1:900 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

WB (Western Blot)

(Western blot analysis of various lysates using Ku80 Rabbit pAb (AAA283251) at 1:900 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates / proteins: 25 ug per lane.Blocking buffer: 3 % nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA283251_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using Ku80 Rabbit pAb (AAA283251) at 1:900 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates / proteins: 25 ug per lane.Blocking buffer: 3 % nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-Xrcc5 antibody
Predicted to enable several functions, including nucleic acid binding activity; protein C-terminus binding activity; and ubiquitin protein ligase binding activity. Predicted to contribute to 5'-deoxyribose-5-phosphate lyase activity and double-stranded telomeric DNA binding activity. Acts upstream of or within several processes, including cellular response to leukemia inhibitory factor; hematopoietic stem cell differentiation; and positive regulation of neurogenesis. Located in cytoplasm and nucleus. Is expressed in thymus primordium. Human ortholog(s) of this gene implicated in chronic obstructive pulmonary disease and multiple myeloma. Orthologous to human XRCC5 (X-ray repair cross complementing 5).
Product Categories/Family for anti-Xrcc5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 83kDa
Observed MW: 83kDa
UniProt Protein Name
X-ray repair cross-complementing protein 5
UniProt Gene Name
Xrcc5
UniProt Synonym Gene Names
G22p2; CTC85; CTCBF

Similar Products

Product Notes

The Xrcc5 xrcc5 (Catalog #AAA283251) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ku80 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Ku80 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the Xrcc5 xrcc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IKKKNQVTAQ DVFQDNHEEG PAAKKYKTEK EEDHISISSL AEGNITKVGS VNPVENFRFL VRQKIASFEE ASLQLISHIE QFLDTNETLY FMKSMDCIKA FREEAIQFSE EQRFNSFLEA LREKVEIKQL NHFWEIVVQD GVTLITKDEG PGSSITAEEA TKFLAPKDKA KEDTTGPEEA GDVDDLLDMI. It is sometimes possible for the material contained within the vial of "Ku80, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.