Rabbit anti-Human Laminin beta 1 Polyclonal Antibody | anti-PRMT2 antibody

Laminin beta 1 Rabbit pAb

Cat. Num. AAA282288

• Gene Names: PRMT2; HRMT1L1
• Reactivity: Human
• Applications: Immunocytochemistry, Immunofluorescence, Western Blot
• Purity: Affinity purification
• Synonyms: Laminin beta 1, Antibody; Laminin beta 1 Rabbit pAb; LAMB1; CLM; LIS5; laminin subunit beta-1; anti-PRMT2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: YNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR

• Applicable Applications for anti-PRMT2 antibody: ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1467-1786 of human Laminin beta 1 (NP_002282.2).
• Cellular Location: Secreted, basement membrane, extracellular matrix, extracellular space
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using Laminin beta 1 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Laminin beta 1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Related Product Information for anti-PRMT2 antibody

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the beta chain isoform laminin, beta 1. The beta 1 chain has 7 structurally distinct domains which it shares with other beta chain isomers. The C-terminal helical region containing domains I and II are separated by domain alpha, domains III and V contain several EGF-like repeats, and domains IV and VI have a globular conformation. Laminin, beta 1 is expressed in most tissues that produce basement membranes, and is one of the 3 chains constituting laminin 1, the first laminin isolated from Engelbreth-Holm-Swarm (EHS) tumor. A sequence in the beta 1 chain that is involved in cell attachment, chemotaxis, and binding to the laminin receptor was identified and shown to have the capacity to inhibit metastasis.

Product Categories/Family for anti-PRMT2 antibody

Signal Transduction; Cell Biology & Developmental Biology; Cytoskeleton; Extracellular Matrix; Cardiovascular; Angiogenesis; Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 46255047
• NCBI GeneID: 3275
• NCBI Accession #: NP_001526
• NCBI GenBank Nucleotide #: NM_001535
• UniProt Accession #: P55345; P78350; Q498Y5; Q5U7D4; Q6FHF0; Q99781; Q9BW15; Q9UMC2; B7U630; B7U631; B7U632
• Molecular Weight: 31,193 Da
• NCBI Official Full Name: protein arginine N-methyltransferase 2 isoform 1
• NCBI Official Synonym Full Names: protein arginine methyltransferase 2
• NCBI Official Symbol: PRMT2
• NCBI Official Synonym Symbols: HRMT1L1
• NCBI Protein Information: protein arginine N-methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HMT1 hnRNP methyltransferase-like 1; PRMT2 alpha; PRMT2 beta; PRMT2 gamma; histone-arginine N-methyltransferase PRMT2
• UniProt Protein Name: Protein arginine N-methyltransferase 2
• UniProt Gene Name: PRMT2
• UniProt Synonym Gene Names: HMT1; HRMT1L1
• UniProt Entry Name: ANM2_HUMAN